KEGG   Lactobacillus casei Zhang: LCAZH_1778Help
Entry
LCAZH_1778        CDS       T01280                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00071  Fatty acid degradation
lcz00072  Synthesis and degradation of ketone bodies
lcz00280  Valine, leucine and isoleucine degradation
lcz00310  Lysine degradation
lcz00362  Benzoate degradation
lcz00380  Tryptophan metabolism
lcz00620  Pyruvate metabolism
lcz00630  Glyoxylate and dicarboxylate metabolism
lcz00640  Propanoate metabolism
lcz00650  Butanoate metabolism
lcz00900  Terpenoid backbone biosynthesis
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01120  Microbial metabolism in diverse environments
lcz01130  Biosynthesis of antibiotics
lcz01200  Carbon metabolism
lcz01212  Fatty acid metabolism
lcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCAZH_1778
   00630 Glyoxylate and dicarboxylate metabolism
    LCAZH_1778
   00640 Propanoate metabolism
    LCAZH_1778
   00650 Butanoate metabolism
    LCAZH_1778
  Lipid metabolism
   00071 Fatty acid degradation
    LCAZH_1778
   00072 Synthesis and degradation of ketone bodies
    LCAZH_1778
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCAZH_1778
   00310 Lysine degradation
    LCAZH_1778
   00380 Tryptophan metabolism
    LCAZH_1778
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCAZH_1778
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCAZH_1778
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCAZH_1778
Enzymes [BR:lcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCAZH_1778
Exosome [BR:lcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCAZH_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADK19004
Position
complement(1736707..1737888)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFSEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLGERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggtgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgtcagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcgggact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggtttttccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctgggtgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system