KEGG   Lactobacillus paracasei Zhang: LCAZH_2568Help
Entry
LCAZH_2568        CDS       T01280                                 

Definition
(GenBank) methyonyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcz  Lactobacillus paracasei Zhang
Pathway
lcz00450  Selenocompound metabolism
lcz00970  Aminoacyl-tRNA biosynthesis
lcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LCAZH_2568
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCAZH_2568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcz01007]
    LCAZH_2568
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcz03016]
    LCAZH_2568
Enzymes [BR:lcz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LCAZH_2568
Amino acid related enzymes [BR:lcz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LCAZH_2568
Transfer RNA biogenesis [BR:lcz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LCAZH_2568
 Prokaryotic type
   Other AARSs
    LCAZH_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADK19758
UniProt: S4ZX47
Position
complement(2513919..2515901)
Genome map
AA seq 660 aa AA seqDB search
MASKPTFYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQ
KADKLGVTPQAYVDGMATQIKQLWKMLEITNDKFIRTTDKEHVEAVQTIVERLIKQGDVY
LGEYTGWYSVEDEEYFTESQLSEVYRDKDGNVTGGKAPSGHEVQLVHEPSYFFKMSKYTD
RLLKYYDEHPDFVQPASRKTEMINNFIKPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVD
ALLNYITALGYGSNDHALFDKYWPANVQLIGKEIVRFHIIYWPIILMALGLPLPKKIYAH
GWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYD
LANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSD
ALDQVWKIVSRANKYIDETEPWNLAKDPAKKDQLDAVMAHLAESLRLIALLIQPVMTHAP
LQIFGQLGLDHENDDHKLVQWGALPAGAKVVEQGTPIFPRLDTEEEVAYIKSKMTPGTTK
ATVDEKTRKSEIEFKQFDKSEIRVAEILNVEPVKGADKLLKFTLDAGDEGTRQILSGIRE
FYPEYEKLKGKKVMAVVNLKPRKLKGEMSEGMLLSAESLDGKKITLLEVSENLENGSLVG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaccaactttttacgtaacaacaccaatttattacccatctggcaaacta
catatcggcaacgcctacaccacgattgcagcagacgtgctcgcacggtataagcggctc
atgggctacgacgttttcttcctaactgggaccgacgaacatggcctgaaaatcgagcaa
aaggctgataagttaggggtgacgccacaagcttatgttgatggcatggcgacccaaatc
aagcaactttggaaaatgcttgaaatcactaatgacaagtttatccggaccactgacaag
gaacatgtcgaagccgttcaaacgattgtggaacgtctcatcaaacaaggggacgtctat
ttaggcgaatacactggctggtactccgttgaagacgaggaatacttcacggaatctcaa
ctgtcagaagtttatcgcgataaagacggcaacgtgaccggcgggaaagcgccgtctggt
catgaagtgcagctggttcacgaaccaagttacttctttaagatgagcaagtacaccgat
cgcttgttgaagtattatgacgagcatccggattttgttcaaccggcttcacgcaaaact
gaaatgatcaataactttatcaaaccgggtctggaagatctggcgatgagccggacgagc
ttcaattggggtgtccagattccatccgatccgaagcacgttgtttacgtgtgggttgat
gcgttgctgaactatattaccgccctaggctatggcagtaatgatcacgctttgtttgac
aaatactggccagccaacgtccaattgattggtaaggagattgttcgtttccacattatc
tattggccaattattttaatggcactcggcttgccgttgccaaagaaaatttatgcccat
ggctggctagtcatgaaagatggcaaaatgagtaagtcgaaaggcaatgccatttatccg
gacatgattgttgaacggtatggcttggatgccttgcggtattacttgatgcgcgccatt
ccgtttggtaatgatggtattttcacaccagaagactttattgaccgaatcaattacgac
ttggccaatgacctcggcaatctgttgaatcggaccattgccatgatcaacaagtatgaa
gacggtattttgccagcctttaagccggatgtaacgccgtttgatcaagatcttggcgat
gtggcgcaggcggctttggcgcaatatcacaaattgatggacgagttgcgtttctccgat
gctttggatcaagtctggaaaattgtttcccgggcgaacaagtatatcgacgaaacggaa
ccgtggaatctggccaaagatcctgccaaaaaagatcagcttgatgctgtgatggctcac
ttggccgaaagtctgcgtctgattgctctactgattcaaccagtgatgacccatgcacca
ttgcaaatcttcggccaacttggcttggatcatgaaaatgacgaccacaagcttgtccaa
tggggcgctttgccagctggtgctaaagtggttgaacaaggcacaccaatcttcccacgt
cttgatacggaagaagaagtcgcttatatcaagagcaagatgacccctggcaccacgaaa
gccactgtcgacgaaaaaacgaggaagtcagaaatcgagttcaaacaattcgataagagc
gaaattcgggtcgcagaaattttgaatgtcgaaccggttaaaggcgctgataagttgttg
aagttcacgctcgatgcaggcgatgaaggcacacggcaaattctttccggtattcgtgaa
ttttacccagaatatgagaagctgaaaggcaaaaaggttatggccgtggtcaacttgaag
ccgcgcaagctaaaaggcgaaatgtctgaaggcatgttgttgtcggctgaaagtttagac
ggcaagaaaatcactttgctggaagtctctgagaacttagagaatggcagcttggttggt
taa

DBGET integrated database retrieval system