KEGG   Lactobacillus paracasei Zhang: LCAZH_2705Help
Entry
LCAZH_2705        CDS       T01280                                 

Definition
(GenBank) pyridoxal phosphate biosynthetic protein PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
lcz  Lactobacillus paracasei Zhang
Brite
KEGG Orthology (KO) [BR:lcz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LCAZH_2705
Enzymes [BR:lcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     LCAZH_2705
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     LCAZH_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADK19891
UniProt: S4ZR51
Position
complement(2649236..2650216)
Genome map
AA seq 326 aa AA seqDB search
MTHFIGITIGDPSGIGPEISLKALMKNEQYLNESIIFGSKEIMTYYADLLKIKTPLNFIK
DVDQFEAGKINIYNVMDIPLDKIPIGEVSPISGDAAFQFLKVAIDLAMKKKIGPVVTAPL
NKDALHKGGHNFDGHTEIFAEFTGTKKYTMMLWSKKLAVVHVSTHVPLRKACDLVTKARV
EECIDLANSAIKRLGISKPRIAVAGLNPHAGEDGLFGDEEIKEINPAVKEKQSQGIDVQG
ALPPDTVFLKASQGKFDIVVAMYHDQGHIPMKLLAFDEGVNVTLGLPIIRTSVDHGTAFD
IAGKGIANESSMLASIALAIKFGHNA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacacattttattgggattacaattggagacccgtctggaattggaccggagatttca
ctcaaggccttaatgaaaaacgagcaatatttgaatgaaagtattatttttggatctaag
gaaatcatgacgtactatgccgatctcttaaagattaagacgcctttgaatttcatcaaa
gatgtcgatcagtttgaagccggaaaaattaatatctataatgtcatggatattccgtta
gataagattccaattggcgaagtaagccctatttcaggcgacgcagcatttcagttctta
aaagtggcaattgatttagcaatgaagaagaaaattggtcctgttgtgacagcgccatta
aataaagatgcgcttcacaaaggcgggcataattttgatggtcatactgaaatctttgct
gagttcactggcactaaaaaatacacgatgatgctatggagcaaaaaactcgcggttgta
cacgtttcgacacatgtgccgttgcgtaaggcatgtgaccttgtgacaaaggctcgagtt
gaagaatgtattgatttagctaacagtgcgataaagcgtcttggtataagcaagcctaga
attgctgttgcaggtttaaatccgcatgctggtgaagatggcttattcggcgatgaggaa
attaaggaaatcaatcctgccgtaaaggagaagcagtcacaagggattgacgtgcagggc
gctctgccgccagataccgttttcttgaaggcttcacagggcaagtttgatattgttgtt
gcaatgtatcatgatcaaggacacattccaatgaaactattggcttttgatgaaggtgtt
aatgttacgctcggactgccaattattcgaacatcagttgatcatgggacggcttttgat
attgctggaaagggcattgctaatgaatcgtcgatgttagcttcaattgcgcttgcgata
aagttcggtcacaatgcgtaa

DBGET integrated database retrieval system