KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0879Help
Entry
Ldb0879           CDS       T00364                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00071  Fatty acid degradation
ldb00072  Synthesis and degradation of ketone bodies
ldb00280  Valine, leucine and isoleucine degradation
ldb00362  Benzoate degradation
ldb00620  Pyruvate metabolism
ldb00630  Glyoxylate and dicarboxylate metabolism
ldb00640  Propanoate metabolism
ldb00650  Butanoate metabolism
ldb00900  Terpenoid backbone biosynthesis
ldb01100  Metabolic pathways
ldb01110  Biosynthesis of secondary metabolites
ldb01120  Microbial metabolism in diverse environments
ldb01130  Biosynthesis of antibiotics
ldb01200  Carbon metabolism
ldb01212  Fatty acid metabolism
ldb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ldb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ldb0879
   00630 Glyoxylate and dicarboxylate metabolism
    Ldb0879
   00640 Propanoate metabolism
    Ldb0879
   00650 Butanoate metabolism
    Ldb0879
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ldb0879
   00072 Synthesis and degradation of ketone bodies
    Ldb0879
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ldb0879
   00310 Lysine degradation
    Ldb0879
   00380 Tryptophan metabolism
    Ldb0879
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ldb0879
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ldb0879
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ldb0879
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ldb04147]
    Ldb0879
Enzymes [BR:ldb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ldb0879
Exosome [BR:ldb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ldb0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAI97700
UniProt: Q1GAH7
Position
769518..770618
Genome map
AA seq 366 aa AA seqDB search
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALRGALKEAGLDAEALDALFMGNVLSAG
LGQNMARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTN
ASKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFAD
EIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVA
EYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLA
VARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIA
FEIEKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttatattgttgcggccaagcgaactccatttggccgttaccacaagcaa
ttggctgacttttctgctatcgacctgggccaaatcgccctgcgcggcgcattaaaagaa
gccggccttgacgccgaagccctggatgccctcttcatgggcaatgtcctgtctgccggc
ttaggccagaacatggcccggcaaattgctttaaacgccgggatgcggcaggactcagtc
gccgtgtccatcaacgaagtctgtggctccagcctcaaggctgcccggctggctgaagcc
caaatgttaatcggtgacctggggctggttgctgtcggcggcagcgagagcatgaccaac
gcctcaaaggaaatcatgttcagcgatggtctcgttgactccttctccggtaaatccatg
ggcattactgccgaaaacgtggctaagcgcaaccacatcagccgccaagacgctgacgcc
ttcagcttgtcctcccaccaaaaagctgtcaaagcacaagctgaaggactttttgccgat
gaaatcattcaaattgaagatctcaagcaagatgaaaacgttcgcccggataccagcctg
gaagccctggccggtcttaaaacttccttccttgaagacgggaccgtcactgccggtaac
gcctccccaatctccgacggggccagcatgatcatcctggctaccgcggaaaaagtcgct
gaataccagctgacgcctttagccaagctgggtgcttacgccgaagtaggctatgacccg
gaattcatgggctatggtccatactatgctatccgtaagctgcttaatgaaactggccgg
caggtagccgattacgacttctttgaaatcaatgaagcctttgccgcaactactttggct
gttgcccgcgacctggaaattcctttagccaaggtcaacaagcagggcggggcgattgct
ttaggccacccgctcggcgcttccggcacccgccttctggctaccgctgcccgccagctg
caaagaggcggccagcgcgctatcgccagcctttgcatcggaggcggcctggccatcgct
tttgaaattgagaaggcataa

DBGET integrated database retrieval system