KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1734Help
Entry
Ldb1734           CDS       T00364                                 

Gene name
gpmA2
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00010  Glycolysis / Gluconeogenesis
ldb00260  Glycine, serine and threonine metabolism
ldb00680  Methane metabolism
ldb01100  Metabolic pathways
ldb01110  Biosynthesis of secondary metabolites
ldb01120  Microbial metabolism in diverse environments
ldb01130  Biosynthesis of antibiotics
ldb01200  Carbon metabolism
ldb01230  Biosynthesis of amino acids
Module
ldb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ldb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ldb1734 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    Ldb1734 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ldb1734 (gpmA2)
Enzymes [BR:ldb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ldb1734 (gpmA2)
Membrane trafficking [BR:ldb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ldb1734 (gpmA2)
Exosome [BR:ldb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ldb1734 (gpmA2)
  Exosomal proteins of melanoma cells
   Ldb1734 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAI98515
UniProt: Q1G8V4
Position
complement(1480942..1481619)
Genome map
AA seq 225 aa AA seqDB search
MAKLALLRHGESQANAANVYTGWNDVPLTDKGRRQAWAAGEKLKEVGDFHPTMIHTSLLS
RAIETANIVAEAAGFLYLHVAKTWRLNERHYGALRGLDKDVSRKIFGKEQVLEWRRGCDA
VPPAQGSPTIDRRYWGVDPQLLPRAESLHQTQLRLLPYYEDEVASRLVAGEDQLIVAHGS
SLRALIKYLEDINNVDILKLEVPNAQAIVYDFDQELNIVDKMITN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttggcactgctgaggcatggggaaagccaggccaatgcggcaaacgtatat
acaggctggaatgacgtccccttaacggataagggccggcggcaggcctgggcagcaggg
gagaaattaaaagaagtcggggactttcacccgactatgattcacacttcccttttgtcg
agggcaattgagacggcgaacatcgtggccgaagccgcgggctttttatacctgcatgtt
gcaaagacctggcggctgaatgaacgccactacggggccctgcggggcctggacaaggac
gtgtccaggaagattttcggcaaagagcaggttttagagtggcggcggggctgtgacgcg
gtcccgccagcgcaagggtcaccaactatcgaccgccgctattggggagtggaccctcag
cttttgccaagagcggagagcctgcaccagacccagctgcgtttgttgccttactatgaa
gacgaggtggccagccgcttagtggctggggaagaccagctgatcgtggcccatggctcc
agcctgcgggcgctgatcaaatatttagaagatatcaacaatgtggatatcctaaagctg
gaggtgcctaacgcccaggccattgtctatgactttgaccaggagctgaacattgtggat
aagatgatcaccaactga

DBGET integrated database retrieval system