KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1772Help
Entry
Ldb1772           CDS       T00364                                 

Gene name
pfk2
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00010  Glycolysis / Gluconeogenesis
ldb00030  Pentose phosphate pathway
ldb00051  Fructose and mannose metabolism
ldb00052  Galactose metabolism
ldb00680  Methane metabolism
ldb01100  Metabolic pathways
ldb01110  Biosynthesis of secondary metabolites
ldb01120  Microbial metabolism in diverse environments
ldb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ldb1772 (pfk2)
   00030 Pentose phosphate pathway
    Ldb1772 (pfk2)
   00051 Fructose and mannose metabolism
    Ldb1772 (pfk2)
   00052 Galactose metabolism
    Ldb1772 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    Ldb1772 (pfk2)
Enzymes [BR:ldb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ldb1772 (pfk2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ldb1772 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAI98546
UniProt: Q1G8T1
Position
1504020..1505099
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLSKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAIDIATRYLDDIHTTAQSHSRVFVVEVMGH
KVGHITLAAGLAAGSDIILLPEIPYDINVVAKKVKERQKSGKGFTVIAAAEGAISKEDAT
LSKKKYKAKVAARNGASVVNEIAAQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKTVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctgtccaagaccctttacaactgtgtcgatgacgtggaaatcatcggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagccgccatgaagaagacctacaagaag
ctcaacctggacgctttggcggttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgattggcctgccaaagaccatcgacaacgacacttgg
gggactgactacaccttcggtttccaaagcgccattgatattgccaccagatacctggat
gacatccacactactgctcaaagccactcccgggtctttgtcgtcgaagtcatgggccac
aaggttggccacatcaccctggccgccggcctggctgccggcagcgacattatcctttta
ccggaaatcccttatgacatcaatgtcgtggccaagaaggtcaaggaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgtccaagaagaagtacaaggctaaggttgccgctagaaacggcgccagcgtggttaac
gaaatcgctgcccaattgcaggaagttttgccagacgctgaaatcagaacggcggtcatc
ggccacgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggcgaagtcgactctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaagaccgtaagcaacgcccgccttatgggagtcacctttggggacaagtaa

DBGET integrated database retrieval system