KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0347Help
Entry
LDBND_0347        CDS       T01360                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lde00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LDBND_0347 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lde03011]
    LDBND_0347 (rplV)
Ribosome [BR:lde03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LDBND_0347 (rplV)
  Bacteria
    LDBND_0347 (rplV)
  Archaea
    LDBND_0347 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADQ60398
Position
359554..359907
Genome map
AA seq 117 aa AA seqDB search
MAEQISSARAEARTVRIAPRKARLVVDLIRGKSVAEALAILKFTPKAASPIVEKVLRSAV
ANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGSASPIMKRTSHVVVVVSELND
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaattagttcagctagagctgaagcaagaactgttcgtatcgccccaaga
aaagctcgtctcgttgtagacttgatccggggtaagagcgttgctgaagcattggcaatt
ttgaagtttacgccaaaagctgcttccccaatcgttgaaaaggttttgcgttcagcagtt
gctaacgcagaacacaactatgatcttgaaagtgcaaacctttacgtatcagaagcatat
gttaacgaaggtgctactttgaagagattccgtccacgtgccaagggttcagcttctcca
atcatgaagagaaccagccacgtagttgttgttgtttcagaattgaacgattaa

DBGET integrated database retrieval system