KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0533Help
Entry
LDBND_0533        CDS       T01360                                 

Definition
(GenBank) Predicted permease
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport Baculo_PEP_C DUF4795
Motif
Other DBs
NCBI-ProteinID: ADQ60582
Position
543205..544359
Genome map
AA seq 384 aa AA seqDB search
MLNNRFSVGLINVLLVLVIVLVFNKISFILNPVNTFISAILPPLLVAMVQYYLMEPVVDK
LEEKFKVPRTVTIMVIFAIVTVFLIWAINSLIPVVQSQIDSLVKNWPTIWKNSTNAVDEL
LHSPKFSGLRDSLQKQMTSLQKNFSKSMGSTVSSALGNLTSAVTVATAVFTTLATAPFLL
FFMLKDGHKLRPFLVKFAPQRWEQATSKLLHEVNQAVSSYVIGQVSVAICVGIMLFIGYT
IIGEPYGAALAICSGFLNLIPYFGTFIGLIPALIIALVTDLSMVAKVLVVFFIEQIIETR
VISPLVVGNRLKMHPATTIVVMLGAGSVWGLWGVIGGIPIYAVMKILLTHVYWYYRKVSH
LYDDSFQDEADQAGREEKERKGNK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaacaaccgcttcagcgtcggcttgatcaatgtgctcttggtcctggtgatcgtg
ctggtctttaacaagatttcctttatcttgaatccggtcaacaccttcatcagcgccatc
ctgccaccccttttggtggccatggtccagtactatctgatggagccggtggttgataag
ctggaagagaagttcaaggtgccgcggacggtcaccatcatggtgatttttgctatagtc
acggtcttcttgatctgggccatcaattccctgattccggtcgtccagagccagattgac
tccttagtcaagaactggcccacgatctggaagaattcgaccaacgcggttgatgagctc
ctgcacagtccgaaattcagcggcctgcgcgattctctgcaaaagcagatgacttctttg
cagaagaatttcagcaagagcatggggtcaaccgtctccagcgccctggggaatttaacc
agcgcggtcaccgtagcgacagccgtcttcacgaccctggccacagctccgtttttgctc
ttctttatgctgaaagacggacacaaactgcggccttttctggtcaagttcgctccccag
cgctgggagcaggcgaccagcaagttgctgcatgaagtcaaccaggctgtgtcttcttac
gtgatcggccaggtttccgtggctatctgcgtggggatcatgttattcattggctatacg
attatcggcgagccttacggggcagccctggcgatctgttctggctttttgaacctgatc
ccttactttgggaccttcatcggtttgattccggccttaatcatcgctttagtgactgat
ttgtcgatggtagccaaggtcttagtggttttctttattgagcagatcattgaaacccgg
gtcatcagcccgctggttgtcggcaaccgcttgaagatgcacccggcgacgacgattgtc
gtcatgctgggggctggctcagtctggggcctgtggggcgtgatcggcgggattccgatc
tacgcggtgatgaaaatccttttgacccatgtctactggtactaccggaaggtttcccac
ctttatgacgacagtttccaggatgaagcagaccaggctggacgagaagaaaaggaaagg
aaaggaaataaatga

DBGET integrated database retrieval system