KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0534Help
Entry
LDBND_0534        CDS       T01360                                 

Definition
(GenBank) RNA methyltransferase, TrmH family, group 2
  KO
K03216  tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lde03016]
    LDBND_0534
Enzymes [BR:lde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     LDBND_0534
Transfer RNA biogenesis [BR:lde03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    LDBND_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase
Motif
Other DBs
NCBI-ProteinID: ADQ60583
Position
544356..544913
Genome map
AA seq 185 aa AA seqDB search
MTNHIVLFEPEIPDNTGNIARTCAGTNTVLDLIEPLGFHLDDKHLKRAVLDYGGEVEIRR
HDDLRAFLATLPDNAEMYLISKFSSKAYTDVDYTDESKDYYFVFGRETTGLPETFMRQYA
DRNLRIPMSDKIRAFNLSNSAAIVIFEALRQQGFPHMEKSHHYENDKLKDDYNRPGRYHR
NLPKH
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccatattgttttgtttgagccggaaattcccgacaacacgggcaacattgcc
agaacctgcgcgggaaccaacacggtgctggacttgatcgagcccttgggcttccacctg
gacgacaagcatctcaagcgggccgttttagactacggcggtgaagttgaaatccgccgc
catgacgacctgcgggcatttctggctactttgccggacaatgccgagatgtacttgatc
tccaagttctccagcaaggcttatactgacgtcgactacacggacgaaagcaaggactac
tactttgtttttggccgggaaacgaccggtttgccggaaaccttcatgcggcaatacgcg
gaccgcaatctccgcattcccatgtccgacaagatccgggccttcaacctgtccaattcg
gcagcgattgtaatttttgaagccctgcgccagcaaggctttccccacatggaaaagtcc
caccactatgaaaacgacaagctcaaggacgactacaatcgtcctggccgctaccatcgg
aacctgcccaagcattag

DBGET integrated database retrieval system