KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0535Help
Entry
LDBND_0535        CDS       T01360                                 

Definition
(GenBank) Hypothetical protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1149 POTRA_TamA_1 DUF4382 PAS_8
Motif
Other DBs
NCBI-ProteinID: ADQ60584
Position
544944..545339
Genome map
AA seq 131 aa AA seqDB search
MEFNKQTPIIVRAFHYDLLDEPEEKNEVNVAIRQVVATGEDGVEDAGEAGGYYEVAVVYD
VTPDEDNIIEISGVNTQVVQLLGYHGDGQDLDQETYRLLSRPLVEYIETLTYEVSQVALD
EPINLDFEPNF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaacaagcagaccccaatcatcgttcgtgcctttcactatgacctgctcgat
gagccagaagaaaagaacgaagtcaacgtagccatccgccaggttgtcgctacgggcgaa
gacggcgttgaagatgccggcgaggcaggcggctactacgaagtagccgttgtctacgac
gttacgccagacgaagacaacatcatcgaaatcagcggggtcaacacccaagtcgttcag
cttctgggctaccacggcgacggccaggacctggaccaggaaacctaccgtttgctcagc
cggccgctggttgaatacatcgaaaccttgacttacgaagttagccaggttgccttggat
gaaccgatcaacttggactttgaacctaatttctaa

DBGET integrated database retrieval system