KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0548Help
Entry
LDBND_0548        CDS       T01360                                 

Definition
(GenBank) Ribosome-associated factor Y
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S30AE Ribosom_S30AE_C
Motif
Other DBs
NCBI-ProteinID: ADQ60597
Position
559949..560506
Genome map
AA seq 185 aa AA seqDB search
MLKYNVRGENIEVTEALRDYVEKRLTKLEKYFDLSQDVIAHVNLKVYRDHSAKVEVTIPL
PYLVLRAEETTDDMYRSIDFVSEKLERQIRKYKTRVNRKSREKGVEEFFIPEEAPVEEEK
EEKAPMFKIVRNKRVSLKPMDPEEAILQMDMLEHDFFVFQDAETNGTSVVYRRNDGSYGL
IETNE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtacaatgttcgtggcgaaaatattgaagtcactgaagctttgagagattat
gttgaaaagcgcttgaccaagttggaaaagtactttgatctgagccaggacgtaatcgct
catgtaaatctgaaggtataccgtgaccactcagctaaggttgaagtaaccattccgctt
ccatacctggttttgagagctgaagaaactacggatgacatgtaccgcagcattgacttt
gtttccgaaaagcttgaacgccaaatcagaaagtacaagacccgcgtcaaccgcaagagc
cgtgaaaagggcgttgaagaattcttcatccctgaagaagctccagttgaagaggagaag
gaagaaaaggctccaatgttcaagattgtccgcaacaagcgggttagcttgaagccaatg
gacccagaagaagccatcttgcaaatggacatgctggaacacgacttcttcgtcttccaa
gacgctgaaacaaacggcaccagcgtggtttatcgccgcaacgacggcagctacggcttg
attgaaactaacgaatag

DBGET integrated database retrieval system