KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0552Help
Entry
LDBND_0552        CDS       T01360                                 

Gene name
hprK
Definition
(GenBank) Serine kinase of the HPr protein, regulates carbohydrate metabolism
  KO
K06023  HPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LDBND_0552 (hprK)
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.-  
     LDBND_0552 (hprK)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     LDBND_0552 (hprK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpr_kinase_C Hpr_kinase_N DRTGG FR47 AAA_29 AAA_16 Sigma54_activat AAA_22
Motif
Other DBs
NCBI-ProteinID: ADQ60601
Position
564548..565519
Genome map
AA seq 323 aa AA seqDB search
MRYMMTNTVKLTEFINDNSNLRVLQGQECVSGKKITVSDVYRPGLELSGYFDFYPADRVQ
LLGRTEISYAARLDHDLRRKVFEKICQKETPCLLVSRNLPVPVELKEAAEAAGTPILISN
DATTYLMSMITQYLAVKLAERSSVHGVLVEVFGMGVLLTGESGVGKSETALALVQHGHRL
IADDRVDVYQRDHETVVGEAPRILKHLMEIRGIGIIDVLKLFGIGAIKDETEISLVINLT
NWDSKANYDRLGFQENTRIICGIAVPQVTIPVKVGRNMENIVEVAVMNFRAKAMGFDAAK
TFDENLTSLIAENSEEEKGGKAD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtacatgatgacgaacacggtaaaactaactgagttcattaatgacaattccaac
ctgcgggttctgcagggacaggaatgcgtgtctggcaagaagattacggtttccgacgtt
taccggccgggactggaattgagcggctactttgacttttacccggctgaccgggtccag
cttctgggcagaacggaaatttcctacgctgcccggctggaccacgacctgcgccggaaa
gtttttgaaaaaatctgccagaaagaaactccctgcctgctggtttcccgcaacctgccg
gtgccggttgaacttaaagaagcggcagaagcagccgggaccccgatcttgatttccaat
gacgccacgacatacttgatgagcatgatcacccagtacctggccgtcaagctggcggaa
agaagcagcgttcacggggtcctggtcgaagttttcgggatgggggttctcttgaccggg
gaatccggggttggcaagtccgaaaccgccctggccctggtgcagcacggtcaccgcttg
atcgctgacgaccgggtggatgtctaccaaagagaccacgagaccgtggtcggggaagct
ccccgtattttgaagcacttgatggaaatccgggggatcgggatcattgacgtcctcaag
ctcttcgggattggggccatcaaggatgaaaccgagatctccctggttatcaacttgacc
aactgggactccaaggccaactatgaccgcctgggcttccaggaaaacacccggatcatc
tgcgggatcgcggttccccaggtcactattccggtcaaggtcggccggaacatggaaaac
atcgtggaagtggccgtcatgaacttcagagccaaggccatgggctttgacgcggccaag
acttttgatgaaaacctgaccagcctgatcgcggaaaacagcgaggaagaaaaagggggt
aaagcagactaa

DBGET integrated database retrieval system