KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0554Help
Entry
LDBND_0554        CDS       T01360                                 

Gene name
gpsA
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00564  Glycerophospholipid metabolism
lde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LDBND_0554 (gpsA)
Enzymes [BR:lde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     LDBND_0554 (gpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N ApbA F420_oxidored UDPG_MGDP_dh_N NAD_binding_2 Semialdhyde_dh 3HCDH_N NAD_binding_10 IlvN ABC1 NAD_binding_8 PDH Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADQ60603
Position
566358..567374
Genome map
AA seq 338 aa AA seqDB search
MTKISVLGAGSWGSVLASMLADNGHEVALYAHRQVIADEINQDHTNLHYMKDWTLNPSVW
ASTDMGQVLKDCDVILFAVPTSAIRSVAKSVRQVLDENGRQPYLVSATKGIEPGTKKLVL
QIFKDEIYPDGFDKMIVLSGPSHAENTAQKDLTAITLASTSLDNAAKMQKIFSNDYVRFY
TSNDPIGVQVGGAVKNVIAIAAGILAGLGYGDNAKAALMTRGLAEITRLGVAFGGQPWTF
SGLSGIGDLIVTCTSVNSRNWRCGYQLGQGKPLDEVLANMGQVVEGATTVKAVYEICDKY
SLDMPISASIYKVLYEEAKIDDEIKLMMSRQMGPEIRI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatttccgttttaggcgccggttcctgggggtcagtcctggcctccatgctg
gctgacaacggccacgaggtagccctttacgcccaccggcaagttattgctgatgagatc
aaccaagatcacactaacctgcactacatgaaggactggaccttgaaccccagcgtttgg
gccagtaccgacatggggcaggttctgaaagactgtgacgttatcctgttcgctgtgccg
accagcgcgatccggtcagtggctaaatcggtccggcaggtcttggacgaaaatggccgc
cagccttacctggtttcagccaccaaggggattgaaccggggactaaaaagctggttttg
cagatttttaaagacgaaatctacccggacggatttgacaagatgatcgtcctgtccgga
cccagccacgcggaaaataccgcccaaaaggacctgacggccattaccctggcttcaacc
agtctggacaacgcggccaagatgcagaagattttttcaaatgactatgtccgcttctat
accagcaacgacccaatcggggtccaggtcggcggggctgttaaaaacgtcatcgccatc
gcggctgggatcctggcgggcctgggctacggggacaatgccaaggcagccttgatgacc
cggggcctggcggaaatcacccgcctgggcgtggcctttggcggccagccttggaccttc
agtggcctgtccgggatcggcgacttaatcgttacttgtacctcagtcaactcccggaac
tggcgctgcggctaccagctgggccagggcaagcccctggacgaagtcttggccaacatg
ggccaggttgttgaaggggccacgaccgtcaaggccgtgtacgaaatctgcgacaagtat
tctttggacatgccgatttcagcttccatctacaaggtcctctatgaggaggccaagatc
gacgatgagatcaagctgatgatgagccggcagatgggaccggaaatcagaatttaa

DBGET integrated database retrieval system