KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0556Help
Entry
LDBND_0556        CDS       T01360                                 

Definition
(GenBank) excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lde00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    LDBND_0556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lde03400]
    LDBND_0556
DNA repair and recombination proteins [BR:lde03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     LDBND_0556
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      LDBND_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 DUF1351 Kinesin DUF2075 AAA AAA_7 Microtub_bd PepSY AAA_33 SWI2_SNF2
Motif
Other DBs
NCBI-ProteinID: ADQ60605
Position
568499..570541
Genome map
AA seq 680 aa AA seqDB search
MIKRQDNNKFELVSPYKPAGDQQQAIDQLTAGFQAGDKEQILKGATGTGKTYTMANVIAK
MNKPTLVITHNKTLVGQLYNEFKEFFPNNAVEYFVSYYDYYQPEAYVPQSDTYIEKDASI
NDEIDQLRHAATSALMSRNDVIVVASVSCIYGLGDPREYAASVLNVYTGQEYERNTLLRD
LVNIQYDRNDIDFQRGRFRVRGDVVEVFPAGYSDRAYRIEFFGDEIDRIVEVDPLTGEVH
GVRDSISLFPATHFMTNDDQLAGAIDRIKAEMDDQVKKFEKEGKLLEAERIKQRTTYDLE
MLREVGYTNGIENYSRQMENRKAGEPPYTLLDFFPKDSLILIDESHATMPEIRAMYNGDR
NRKQTLIDYGFRLPSALDNRPLKLEEFEQHVNQIMYVSATPGDYELNQTSRIVEQVIRPT
GLLDPKIEVRPIEGQIDDLVAEINLRIERKERVFVTTLTKKMAEDLTDYLKDLGIKVRYL
HSDIKTLERMQIIRDLRLGKFDVLIGINLLREGIDVPEVSLVAILDADKEGFLRAYRPLI
QTMGRAARNANGEVIMYADRITDSMKLAIDETNRRRAIQMKYNEEHGIVPKTIIKPVRDM
ISVVKADKEAEKSDSFADLNFDELTAKQKKQMIANLNEQMQDAAKRLDFESAANLRDAII
ELEGSVRKPIKKKGKDFNGR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgattaagcggcaagacaataacaaatttgaactcgtctcaccatataagccggccggt
gaccagcagcaggccatcgaccagctgacggccggttttcaagccggcgataaagagcag
atcctcaagggggcaacggggacggggaagacctataccatggccaatgtaattgccaaa
atgaacaagccgaccctggtcattacccacaacaagaccctggttggccagctctacaat
gaatttaaggaatttttcccgaacaacgccgtggaatacttcgtttcctactatgactac
taccagccggaagcctacgtgccccagtcagacacttacattgaaaaagacgcctcgatc
aacgacgaaatcgaccagctgcggcacgccgccaccagcgccttgatgtccagaaatgac
gtcatcgtggtggcttccgtttcctgtatatacggcttgggtgacccaagagaatacgcg
gccagcgtgttaaacgtctatactggccaggaatacgaaagaaacaccctgctcagagac
ttggtcaacatccagtacgacagaaacgacatcgacttccagcggggccgcttccgggtc
cggggcgacgtcgtggaagttttcccggccggctattctgaccgggcctaccggattgaa
ttttttggcgacgaaatcgaccggattgtcgaagttgaccccttgaccggggaagtgcac
ggggtcagagacagcatctcccttttcccggccacccacttcatgaccaacgatgatcag
ctggccggggctatcgaccggatcaaggctgagatggacgaccaggtcaagaagtttgaa
aaagaaggcaagctgctggaggcagaaagaatcaagcagcggaccacctacgacttggaa
atgctgagagaagtcggctacaccaacgggattgaaaactactcccggcagatggaaaac
cgcaaagctggtgagccgccatacacccttttggacttcttccccaaggattccctgatt
ttaatcgacgaatcccacgctaccatgccggaaatccgggccatgtataacggggacaga
aacagaaagcagaccttgattgactatggcttccgcctgccatcagccttggacaaccgg
cccctaaagctggaagaatttgagcagcatgtcaaccagatcatgtatgtgtcagccacc
ccgggtgactatgaattaaaccagactagccggatcgtggaacaggtcatccggccgacc
ggccttttggacccgaagatcgaggtccggccaattgaagggcagatcgatgacttggtt
gctgaaatcaacctgcggattgaaagaaaggaacgggtttttgtcactactttgaccaaa
aagatggctgaagacttgaccgactacttgaaagacctgggcatcaaggtccgctacctg
cactcggacattaaaaccctggaaagaatgcagatcatccgcgacctccgcttgggcaag
tttgacgttttgatcgggatcaacttgcttagggaagggatcgacgtaccggaagtttcc
ctggtggccattctggacgcggacaaggaaggcttcctgcgggcctaccggccgctgatc
cagaccatgggccgggcggcccggaacgccaacggtgaagttatcatgtatgctgaccgg
atcaccgattccatgaagctggcgattgatgaaacgaaccgccgccgggccatccagatg
aagtacaatgaagagcatgggatcgtgccaaagaccatcatcaagccggtccgggatatg
atctccgtggtcaaggccgacaaggaagccgaaaagtcagactccttcgccgacctcaac
ttcgacgagctgacggccaagcagaagaagcagatgatcgccaacttgaacgagcagatg
caagacgcggccaagcgcttggactttgaaagcgcggctaacctccgcgacgcgattatc
gaattggaaggctctgtaagaaaaccgattaagaagaaaggcaaggacttcaatggcaga
tag

DBGET integrated database retrieval system