KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0562Help
Entry
LDBND_0562        CDS       T01360                                 

Definition
(GenBank) P-loop ATPase family protein
  KO
K06958  RNase adapter protein RapZ
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lde03019]
    LDBND_0562
Messenger RNA biogenesis [BR:lde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     LDBND_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_2 AAA_18 AAA_22 Myosin_head AAA_33 AAA_24 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ADQ60610
Position
575903..576781
Genome map
AA seq 292 aa AA seqDB search
MHEKHKKQLLILTGMSGAGKTVAAHSLEDVGYFVVDNLPPELLGNFWDLMNTSEDFEKVA
VVIDLRVKSFYKDLIDEINSLEDSGQTQATIVFLEASDDTLVARYKETRRLPPLAENGRL
LDGIRDERRILTPVRNRSNYILDTSKMTTKELKQKLQSKFGELHKPKFGIEVMSFGFKYG
MPIDADIVMDVRFLPNPFYIPELRPFTGLDKRVFNYVMDKDETKVFYGKLLDLLLTAIPG
YIDEGKEKLTIAIGCTGGQHRSVSIAQQLARDLSEKYPVDITHREISRYLRK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaaacacaagaaacagctgttgattttgacggggatgagcggggccggcaag
acggtcgccgcccactcattagaagatgtcggctacttcgtggttgacaacctgcccccg
gaattgctgggcaatttctgggacttgatgaacacttcggaagactttgaaaaagttgcc
gtggtgatcgacctcagggtcaagtccttctacaaggacctaatcgacgaaatcaactcc
ctggaagacagcggccagacccaggccacgattgtctttttggaagcttctgacgacacc
ttggtggcccgctacaaggaaacccgccgcctgccgcctttagcggaaaacggccgcctt
ttagacgggatccgggatgaacgccgcattttgactccggtcagaaaccggtccaactac
attttggatacctccaagatgacgacgaaggaactgaagcagaagctgcagagcaaattc
ggggaactccacaagccaaaatttgggattgaggtcatgtccttcggcttcaaatatgga
atgccaattgacgctgacatcgtcatggatgtccgctttctgcctaatcccttctacatt
ccggaactgcgtcccttcacggggctggacaagcgggtcttcaactatgtcatggacaag
gatgaaaccaaggtcttttatggcaagctgctggacctcttgttgacagcaattcccggc
tacattgacgaaggcaaggaaaaactgacgatcgccatcggctgcacgggcggtcagcac
cgcagcgtttcgatcgcccagcagctggcgcgcgacttgtctgaaaaatatccggttgac
attacccaccgggaaatcagccgttatctcagaaagtag

DBGET integrated database retrieval system