KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0565Help
Entry
LDBND_0565        CDS       T01360                                 

Gene name
clpP
Definition
(GenBank) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lde01002]
    LDBND_0565 (clpP)
Enzymes [BR:lde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     LDBND_0565 (clpP)
Peptidases [BR:lde01002]
 Serine Peptidases
  Family S14: ClpP endopeptidase family
   LDBND_0565 (clpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CLP_protease
Motif
Other DBs
NCBI-ProteinID: ADQ60613
Position
complement(578818..579402)
Genome map
AA seq 194 aa AA seqDB search
MLVPTVIEQTARGERAYDIYSRLLKDRIIMLSGEVNDQMANSIIAQLLFLDAQDNTKDIY
MYINSPGGVITSGMAIVDTMNFIKSPVSTIATGMAASMASIILAEGEKGKRFALPHATVL
IHQPLGGAQGQATEIQIAAEEILKTRKMINEILAKDSGQDIETIKRDTERDHYMTAQEAK
DYGLIDDIMVNQNK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgttagtacctacagttattgaacaaacggcccgcggcgaacgcgcttatgacatttac
tcccgcttgctgaaggaccggatcatcatgctgagcggtgaagttaacgaccaaatggcc
aactccatcattgcccagctgcttttccttgatgcgcaagacaatactaaagacatttac
atgtacatcaactcaccaggcggtgtgatcacttccggcatggctatcgtggacaccatg
aacttcatcaagtcaccagtttccaccattgccaccggtatggcagcttccatggcctca
atcattttggctgaaggcgaaaagggcaagcgttttgccctgccgcacgctactgtcctc
atccaccagcctttgggcggggcgcaagggcaagccacggaaatccaaattgccgctgaa
gaaatcttgaagaccagaaagatgatcaatgaaatcttggccaaggactccggccaggac
atcgaaaccatcaagcgcgacactgaacgcgaccactacatgaccgctcaggaagccaag
gactacggcttgattgacgacatcatggtcaaccaaaacaagtaa

DBGET integrated database retrieval system