KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0566Help
Entry
LDBND_0566        CDS       T01360                                 

Definition
(GenBank) Hypothetical protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ60614
Position
579520..579768
Genome map
AA seq 82 aa AA seqDB search
MSLCEKAFLAGKNLIYIESEKEMDKKLLCLLLLAAAFIGQAQTAQAATVSKMPGTKNMGI
YAKVTKKGASKKVTTTKYFKYS
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgtgtgaaaaggcttttttagctggaaagaatctaatttatatagaaagtgaa
aaagaaatggataagaaactgctctgcttgctcctgctggcggcggcctttattggccag
gcccaaacggcccaggcggccacggtcagcaagatgcctggcacgaaaaacatggggatc
tatgccaaagtaaccaagaagggcgccagcaagaaagtgacgaccactaagtactttaag
tacagctag

DBGET integrated database retrieval system