KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0573Help
Entry
LDBND_0573        CDS       T01360                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00010  Glycolysis / Gluconeogenesis
lde00051  Fructose and mannose metabolism
lde01100  Metabolic pathways
lde01110  Biosynthesis of secondary metabolites
lde01120  Microbial metabolism in diverse environments
lde01130  Biosynthesis of antibiotics
lde01200  Carbon metabolism
lde01230  Biosynthesis of amino acids
Module
lde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0573 (tpiA)
   00051 Fructose and mannose metabolism
    LDBND_0573 (tpiA)
   00562 Inositol phosphate metabolism
    LDBND_0573 (tpiA)
Enzymes [BR:lde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LDBND_0573 (tpiA)
Exosome [BR:lde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LDBND_0573 (tpiA)
  Exosomal proteins of bladder cancer cells
   LDBND_0573 (tpiA)
  Exosomal proteins of melanoma cells
   LDBND_0573 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ADQ60621
Position
586714..587472
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNL
HVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLEIREAGKEKEWVVSQIKADLEGLTSEQVSKLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANIKELMAKPNIDGGLVGGASLV
PDSYLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaccccaattattgctggtaactggaagctgaacatgaacccaaaggaaact
gttgagttcgtaaacgctgttaaggaccaattgccagacccatcaaaggttgaatcagtg
atttgtgcaccagcagttgacttggacgccttgctgaaggctgccgaaggctcaaacctg
cacgtcggtgcagaaaactgctactgggaaaactccggtgccttcactggtgaaacttct
ccagcagttttgaaggaaatgggcgtgcaatacgtcatcatcggacactcagaacgccgt
gactacttccacgaaactgacgaagacatcaacaagaaggccaaggctatctttgccaac
ggcttgactccaatcctttgctgcggtgaatcactggaaatccgggaagccggcaaggaa
aaagaatgggttgtcagccaaatcaaggctgacctggaaggcttgactagtgaacaagtt
tccaagctggtgatcgcttacgaaccaatctgggcgattggcactggcaagactgcttca
agcgaccaagctgaagaaatgtgcaagactatccgggaaactgttaaggacttgtacaac
gaagaaactgctgaaaacgtccgcatccaatacggcggttcagtaaagccagccaacatc
aaggaattgatggctaagccaaacatcgacggtggcttggttggtggtgcatcattggta
ccagactcatacctggctttggtaaactaccaagactaa

DBGET integrated database retrieval system