KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0589Help
Entry
LDBND_0589        CDS       T01360                                 

Definition
(GenBank) Predicted hydrolase of the HAD superfamily
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6 Trehalose_PPase HAD
Motif
Other DBs
NCBI-ProteinID: ADQ60637
Position
601048..601860
Genome map
AA seq 270 aa AA seqDB search
MAIKMLAIDLDGTLLTDSKTILPGTYKALQEAKAAGIKIVLTSGRPLSGIKGYAEELGLS
GSEEYAILFNGAVVQNLDGRVLISHDLDFGDFNTLLHMQRLSDVNLDFETPDRFYTLDKK
ISIRLQIDGAETKNQLWIQDRSDFKKDFTFAKAVYQCDDPDQVDRLWNRLPDWFFQSYAV
VRSWPEVVEVGSLAASKGYAVSELASRLGLSNSEVMIFGDQGNDRSMFEIPDFKRVAMGN
AIDEIKDLADYVTDTNERDGIAKALRKLVL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaaatgctggccatcgacttagatggcaccctgctaactgacagcaagacg
attctgcccgggacctacaaggccttgcaggaagcaaaagcagccgggatcaagattgtg
ctgacttctggccggcccttgtcgggcatcaagggctacgcggaagaattaggcttaagc
ggcagtgaagagtacgcgatcctcttcaacggggcggtagtgcagaacttagacggccgg
gtcctgatcagtcatgatctggactttggcgacttcaacaccctcctgcacatgcagcgg
ctcagcgacgtcaacctggactttgaaactccggaccgtttttacactttggacaagaag
atttccatccgcctgcagattgacggggcggaaaccaagaaccagctctggattcaagac
agaagcgacttcaagaaggactttacctttgccaaggcagtctaccagtgcgatgacccg
gaccaggtcgaccgcctctggaaccggctgccggactggttcttccagtcctacgcagtt
gtccgcagctggccggaagtcgttgaagtcgggtcactggccgcttcaaagggctacgcg
gttagcgaattggcctcaagactgggcctgtcgaacagtgaagtcatgatcttcggtgac
cagggcaatgaccggtccatgtttgaaatccctgacttcaagcgggtggccatgggtaat
gccatcgacgagatcaaggacctggctgactacgtcaccgacaccaacgagcgcgacggg
atcgccaaggccctgcggaaattagttttataa

DBGET integrated database retrieval system