KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0593Help
Entry
LDBND_0593        CDS       T01360                                 

Definition
(GenBank) Cation transporting P-type ATPase (Probable copper transporter)
  KO
K17686  Cu+-exporting ATPase [EC:3.6.3.54]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
Enzymes [BR:lde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     LDBND_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ADQ60641
Position
603776..605692
Genome map
AA seq 638 aa AA seqDB search
MKLTNWRRFWLSLFLALPMLAQMLLMIWGIMLPGIKIYSLIATSLIMLIGAGPYIQSAWA
ALKRHQANMNSLIAIGTSVTYVYSLFAYFTDRPVYFESAAFILIFVLLGDALEEKMHDRA
AASLNKLLELQASEAEVKRGEDFVKLPLDQVKAGDIIKVRPGGKVPVDGRLVSGQSSVNE
AMVTGESMPVAKKPGDRVIGATINGSGSFLMVAEQVGEETMLAQIVKVVKQAQNSRAPIQ
KLTDKVANYFVPAVLIVSILTFAIWDVFSPVGPVKAMLYAVSVIVIACPCALGLATPTAL
MVASGRSARMGVLIKDGEILEAAAKIKTIVFDKTGTLTVGQPQLVDQVGDKASLSLAASL
EANSEHPLAQAIVTSAKKGGQPLLPVSDFLAEEGKGVEGKVAGHLVKVGRADYVSAPDAW
RQQAEGLAEAGKTVVYVQKDSAVIGLLALQDAPRPEAKAVLSELKSRGIKTVMLTGDNQQ
LAEKIGRQLGIDQVEAGLLPGEKADRLAKLQEAGPVAFVGDGINDAPALSLADVGIAMGS
GTDVAKEAGGIVLMTSDLTGVLRALDLSKQTFTRIKLNLFWALIYNLIGIPVAAGLFSFI
GVSLSPELAALAMAFSSVSVLLSSLMLNWTKIAGAGKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgactaattggcgccgcttttggctgtccctgtttttggccctgcccatgctg
gcccagatgctgttgatgatctggggaatcatgctgccagggatcaagatctattcgctg
atcgccaccagcttgatcatgctaattggggcaggaccttacattcaaagcgcctgggca
gctttgaaacgccaccaggccaacatgaacagcctaatcgccatcggcactagcgtgact
tatgtctacagtctttttgcctacttcactgaccggccggtctactttgaaagcgcggct
tttatcttgatttttgtcttgctaggggatgccctggaagaaaaaatgcatgaccgggca
gcagcttctttgaataagttactggaactccaggccagtgaagctgaggtcaagcgggga
gaagactttgttaagcttcccttggaccaagttaaggccggcgacataatcaaagtgcgg
ccgggcggcaaggtaccggttgacggccggcttgtatccgggcaaagcagcgtcaatgaa
gccatggtgactggggagagcatgccagtcgcgaaaaagcccggtgacagggtgatcggg
gcaaccatcaacggcagcggcagctttttgatggtggctgagcaggtcggggaagagacc
atgctggcccagatcgtcaaagtggtcaagcaggcccagaactcccgggccccgatccaa
aaactgactgataaggtggctaactacttcgtgccggcggtattgatcgtcagcatcctg
acctttgctatttgggatgtcttcagtcccgtgggcccggttaaagccatgctctacgca
gtttccgtcatcgtgatcgcctgcccgtgtgccttaggtttagctaccccgacagctttg
atggtggccagcggccgcagcgcccggatgggggttttgatcaaggacggggaaatcctg
gaagcagccgcgaaaatcaagactattgtttttgacaagaccgggacgttaacggtcggc
cagccccagctggtggatcaggtgggggataaagcaagccttagcctggcggccagtctg
gaagccaattcagaacaccctttggcccaggccattgtgaccagcgctaaaaaaggcggc
cagcctctcttgccagtcagcgattttttggctgaagaaggcaagggggtagaaggcaag
gtagctggtcacttagttaaggtgggccgggctgactacgtcagcgccccagacgcttgg
cgccagcaggcagaaggcttggcggaagccggcaagacggtggtttatgtccaaaaagat
tccgccgtcattggcctcttggccctgcaggatgctccccgcccagaagcaaaggccgtc
ctcagcgagcttaaaagccgggggatcaagacggtcatgttaactggcgacaaccagcag
ctggcggaaaaaatcggccgccagctgggcattgaccaggtcgaagcgggacttttgccc
ggggaaaaagctgaccgcttggccaaattgcaagaagcagggcccgtggcctttgtcggc
gacggcattaatgatgcgccggccttgtcactagccgatgttggcattgccatgggcagc
gggaccgacgtggccaaggaagccggcggcatcgtcttgatgactagcgacttgaccggg
gttttgcgggcgcttgacttgtccaagcagaccttcacgcggatcaagctgaaccttttc
tgggccttgatctacaatttgatcgggattccggtcgcggccggcctcttctcctttatc
ggggtcagcctcagcccggaactggccgctttggccatggccttcagctccgtctcagtc
ttgctgtcatcattaatgttgaactggactaagatcgccggggcgggcaaaaactga

DBGET integrated database retrieval system