KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0596Help
Entry
LDBND_0596        CDS       T01360                                 

Definition
(GenBank) Hypothetical membrane protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HXXEE
Motif
Other DBs
NCBI-ProteinID: ADQ60644
Position
606591..607340
Genome map
AA seq 249 aa AA seqDB search
MKKSQLILRKSLCSLAAIISLVALLSSPVTFKMYEVKDYASSLIDTFANQSDVSAMSIAA
KAAVESGLKQDLVDQLPDKVEISESHLSLYWLVSRYRQNKRLQSSDLKLPAKNKVQLFMD
DLILYLVNSELKVHEGELQQITQIYQLSLWIICVLYLLGVALLLFNRYWSWLPFVLGAAS
AFGFQVFITHTLTEMVQKEVYSKMLFTYSWGSWAGFLLALALAGYLFYLDVCRYRAKGKA
NKNKKANNN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagccaactgattctgcgcaagagcctgtgcagcctggcagccataatttcc
ctggtcgctcttttgagcagccctgtcacctttaaaatgtatgaggtcaaggactatgcg
tccagtttgatcgacactttcgccaaccaaagcgatgtcagcgccatgtcgatcgcggcc
aaagccgcggtagaatcgggcctgaagcaggacctggttgaccaattgccagacaaggtg
gagattagcgagtcccatctcagcctctactggctggtttcccgctaccggcaaaacaag
cgtctgcagtccagcgatttaaagctgccagccaagaacaaggtccagctttttatggat
gacttgatcctctatttggtcaacagtgaactgaaggtgcatgaaggggaattgcagcag
attacgcaaatctaccagctctccttgtggatcatctgcgtcctttacttgctgggcgtg
gccctgctcctcttcaaccgttactggtcctggctgccttttgtgctgggagcggccagt
gcctttggcttccaggtctttattacccataccttgacggaaatggtccaaaaagaagtt
tactccaagatgctgttcacctattcttggggcagctgggccggctttcttctggccctg
gccctggccggctaccttttttatctggatgtttgccgttatcgggcgaagggaaaggct
aataagaataaaaaagcgaataataattaa

DBGET integrated database retrieval system