KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0597Help
Entry
LDBND_0597        CDS       T01360                                 

Definition
(GenBank) Signal transduction diguanylate cyclase
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF
Motif
Other DBs
NCBI-ProteinID: ADQ60645
Position
607554..608450
Genome map
AA seq 298 aa AA seqDB search
MKKRAKQAELAKIAQSEAPIALYQSKNKQIKAIAVSKDLCELYGLPAAELKQLLGQDLEA
DRVTLMEIHGDVARSTHSWQRPGVAEFSAKQQVISLAKATVSLSKLDLFNDDSLFLTDPQ
AIAASFPQIVACYGGDYQLNNGLLAPFYERGELRGLVAVENLNPALNLDFNYLIELTADF
VGAKVTGKNLEEQRDNDVLTKLNDRHPYLAKLNFYQKSQTSRTVGVAFMDLNGLKKANDE
LGHDAGDKMLIAPGNLISQAFGRDYVYRVVGDEFVVLDDQSGQTEFESHCAAFEKALT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagcgaagcaggctgagctggctaaaatcgcgcagagcgaagcaccaata
gcactttatcaatcaaaaaataagcagattaaagccatagccgtgtctaaggacctgtgt
gagctctatggcctgccggcagctgagcttaaacagctgctgggccaggacctggaagca
gaccgggtcactctaatggaaatccatggagatgtggccagaagcactcatagctggcag
cggccaggagtcgctgaattctcagccaagcagcaggtaatcagtcttgcaaaggcaaca
gttagcttaagcaagctggatttgtttaatgatgacagtttgtttttgaccgatcctcaa
gcaatcgcggcatcttttccgcaaatcgtggcctgctatgggggtgactaccagttaaac
aacggtttgctggcaccattctacgaaagaggggaattgagaggcctggtagctgttgaa
aacctcaacccggccttgaacctggatttcaattacttgattgaactgacggccgacttc
gttggagccaaggtaaccggcaaaaatttggaagagcaaagagataatgatgtcttgacc
aagctgaatgaccgccacccttacctggccaagctgaacttctaccagaagtcccagact
tcaagaacggtgggcgtggccttcatggacttgaacggcttgaaaaaggccaatgatgaa
ctgggtcatgatgccggggataaaatgctgattgcgcccggaaacttgatcagccaggct
tttggccgcgactatgtctaccgggtcgtcggggatgagttcgtggttttggatgaccag
agcggccagacggaattcgaaagtcattgtgctgcttttgagaaagctttaacctag

DBGET integrated database retrieval system