KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0622Help
Entry
LDBND_0622        CDS       T01360                                 

Gene name
pgi
Definition
(GenBank) Glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00010  Glycolysis / Gluconeogenesis
lde00030  Pentose phosphate pathway
lde00500  Starch and sucrose metabolism
lde00520  Amino sugar and nucleotide sugar metabolism
lde01100  Metabolic pathways
lde01110  Biosynthesis of secondary metabolites
lde01120  Microbial metabolism in diverse environments
lde01130  Biosynthesis of antibiotics
lde01200  Carbon metabolism
Module
lde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0622 (pgi)
   00030 Pentose phosphate pathway
    LDBND_0622 (pgi)
   00500 Starch and sucrose metabolism
    LDBND_0622 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    LDBND_0622 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lde04147]
    LDBND_0622 (pgi)
Enzymes [BR:lde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     LDBND_0622 (pgi)
Exosome [BR:lde04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBND_0622 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   LDBND_0622 (pgi)
  Exosomal proteins of colorectal cancer cells
   LDBND_0622 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ADQ60670
Position
630201..631541
Genome map
AA seq 446 aa AA seqDB search
MNSVVSFDSSKLTPFVHENELKEMQAMVNAADKELREGTGAGNDFRGWLDLPVDYDKDEF
ARIKKAAKKIQSDSDVLIGIGIGGSYLGAQAAIEFLNSSFYMAEKSDYPKVVFCGNSLSG
TYLSDLINWLGDKDFSLNIISKSGTTTEPSVAFRVLKAKLIEKYGKEEAAKRIYATTDRQ
KGALKTEADAEGYEEFVVPDDVGGRFSVLSAVGLLPIAAAGCDIDALMQGAADARAAYTD
PDVSKDSPYQYAALRNILYRKGYTTELLENYEPSIRMFGEWWKQLMGESEGKDQKGIYPS
SANFTTDLHSLGQYIQEGRRNLIETVVRVASPRADVEIPNDESNLDQLNFLAGKNMNYVN
DRAYEGVVLAHTDGGVPVMTVNIADQSEHTLGYLIYWFELSVAISGYLNGINPFNQPGVE
AYKRNMFGLLNKPGYEDLHDELASRL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgtagtaagttttgacagtagtaaattgaccccttttgttcacgaaaacgaa
ctgaaggaaatgcaagcaatggttaacgccgctgacaaggaattgcgcgaaggcactggt
gccggcaacgacttccgcggctggctggacctgccagttgactatgacaaggacgaattc
gcccgcatcaagaaggctgccaagaagatccaaagcgactctgacgttttgatcgggatc
gggatcggcggctcatacttgggtgcccaagcagccattgaattcttgaactcatcattc
tacatggctgaaaagagcgattatcccaaggttgtcttctgcggtaacagtctgtcaggc
acttacttgtcagacttgatcaactggctgggcgacaaggacttctccttgaacatcatc
tccaagtccggtaccaccactgaaccttcagttgccttccgggttttgaaggccaagttg
attgaaaagtacggcaaggaagaagcagccaagcgtatttacgcaaccactgaccgccaa
aagggtgccttgaagaccgaagctgacgctgaaggctacgaagaattcgtagttccagat
gacgtcggcggccgtttcagcgttttgtcagctgttggccttttgccaatcgctgctgcc
ggctgcgacatcgacgccttgatgcaaggtgccgctgacgcccgggctgcttacactgac
cctgacgtaagcaaggactcaccttaccaatacgctgccttgagaaacatcctttaccgc
aagggctacaccactgaacttttggaaaactacgaaccaagcatcaggatgtttggcgaa
tggtggaagcaattgatgggtgaatcagaaggcaaggaccaaaagggcatctacccgtca
agtgctaacttcaccactgacctgcactcacttggccaatacatccaagaaggccgccgg
aacttgatagaaactgttgtccgcgttgctagcccacgggctgacgtagaaattccaaac
gacgaaagcaaccttgaccaactgaacttcctggccggcaagaacatgaactatgtcaac
gaccgggcttacgaaggcgttgttttggcccacactgacggcggggttccagttatgact
gtcaacatcgctgaccaaagcgaacacactttgggctacttgatctactggttcgaactg
tcagttgctatctccggctacttgaacgggatcaacccattcaaccagccaggggttgaa
gcttacaagcgcaacatgttcggccttttgaacaagccgggctacgaagacttgcacgac
gaactggcaagccgcctgtaa

DBGET integrated database retrieval system