KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0623Help
Entry
LDBND_0623        CDS       T01360                                 

Definition
(GenBank) Lipoprotein, peptide binding protein OppA-like protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde01501  beta-Lactam resistance
lde02010  ABC transporters
lde02024  Quorum sensing
Module
lde_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:lde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LDBND_0623
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LDBND_0623
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    LDBND_0623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lde02000]
    LDBND_0623
Transporters [BR:lde02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    LDBND_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 HdeA
Motif
Other DBs
NCBI-ProteinID: ADQ60671
Position
631713..632261
Genome map
AA seq 182 aa AA seqDB search
MSSRKIALTGLALAALTLTACSKQESSQKEQDLNWSVGGEITTMDPSKATDVVSFSQMIN
LRDGLYRNSKDRQSPGLATSAQVSKDGLIYTFNLRKSKWNDGTPVTAQDFVYSWRRTVNP
KTEAEYSYLFSGIKNADAIQNGKKPVSSLGIKAEGKYKLVVTLEKRMAYFKDLMAFPVFF
PQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagaaaaattgccttgaccggacttgctttagctgctttaacgttaacagcc
tgcagcaagcaggagagcagtcaaaaggagcaggatttgaactggtcagtcggcggggaa
atcaccacgatggacccgtccaaggccacggacgtggtcagcttcagtcagatgatcaat
ttaagggacggtctctacagaaacagcaaggacaggcaaagtccgggcctagccactagc
gcccaggtttccaaggacgggctgatttatactttcaacttgcgcaagtccaagtggaat
gatggcacgcccgtaactgctcaagactttgtctactcctggcggcggaccgtcaatccc
aagactgaggccgagtactcgtatcttttttccgggatcaagaacgccgatgccatacaa
aacggcaaaaagccggtttccagcctggggatcaaggccgagggcaagtataagctggtc
gtcactttagagaagcggatggcctattttaaggacctcatggccttcccagtctttttc
ccgcagtag

DBGET integrated database retrieval system