KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0625Help
Entry
LDBND_0625        CDS       T01360                                 

Definition
(GenBank) Hypothetical protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ60673
Position
632959..633108
Genome map
AA seq 49 aa AA seqDB search
MSKAESILLDDTGVIPLYYEDDAWLIRSNAKGWICKRSEWNFKEAYVTK
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaggcggaaagcatcctgcttgacgataccggggtcatcccgctttactatgag
gatgatgcctggctgatccggtcaaatgccaagggctggatctgcaagcggagcgagtgg
aactttaaggaagcctatgtgactaagtaa

DBGET integrated database retrieval system