KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0632Help
Entry
LDBND_0632        CDS       T01360                                 

Gene name
prfA
Definition
(GenBank) Peptide chain release factor 1
  KO
K02835  peptide chain release factor 1
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lde03012]
    LDBND_0632 (prfA)
Translation factors [BR:lde03012]
 Eukaryotic Type
  Release factors
   LDBND_0632 (prfA)
 Prokaryotic Type
   LDBND_0632 (prfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1 ABC_tran_CTD B277 Macoilin
Motif
Other DBs
NCBI-ProteinID: ADQ60679
Position
638606..639691
Genome map
AA seq 361 aa AA seqDB search
MDNVMAQLESLEVRYEEIQEMMADPEVIADTKRYMEITKEEADMREVVQKFRKFKADKEE
IAGNKEIIADGSDPELVEMAKMENSELEDEISQLEDEIKILMLPKDPNDDKDIIMEIRGA
AGGDEASLFAGDLLRMYEKYAENQGWNVSIVDSEQTEVGGYKRVAIMITGNKVYSKLKYE
NGAHRVQRIPVTESAGRVHTSTATVAVMPEYEQVDIDLDPKEIRVDVYRSSGAGGQHINK
TSSAVRMTHLPTGIVVAMQDQRSQQQNRAKAMEILKSRVYDYYESQNRDKYDAKRKNAVG
TGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDEVIDALTVYYQTKQLEELAEN
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggataatgtaatggcacagctggaaagcttggaagtgcgctatgaagaaattcaggaa
atgatggccgacccggaagtcatcgctgataccaagcgctacatggaaattaccaaggaa
gaagctgacatgcgggaagtcgtgcagaagttccgcaagttcaaggccgacaaggaagaa
attgccggcaacaaggaaatcatcgctgacggttcagaccctgagctggttgaaatggcc
aagatggaaaactctgagctggaagatgaaatcagccagctggaagatgaaatcaagatc
ttgatgttgccaaaggaccctaacgatgacaaggacatcatcatggaaatccggggggca
gccggcggggatgaagcttccctgttcgcgggcgacctgctgcggatgtatgaaaagtac
gcggaaaaccagggctggaacgtttctatcgtcgacagcgaacaaactgaagttggcggc
tacaagcgggtggccatcatgattactggtaacaaggtctactccaagctgaaatatgaa
aacggggcccaccgggtgcagcggatcccagtaactgaatcagccggccgggtgcacact
tcaactgctaccgttgccgtcatgccagaatatgaacaggttgacattgaccttgatcca
aaggaaatccgggtggacgtctaccggtcatccggtgcgggcggtcagcacatcaacaag
acttccagtgccgtcagaatgacccacttgccaaccggtatcgtggttgccatgcaggac
cagcggtcccagcagcaaaaccgggccaaggctatggaaattttgaagtcccgggtttac
gactactatgaaagccagaaccgggacaagtacgacgccaagcggaagaatgcggtcggc
accggtgaccggtcagaaagaatcagaacctacaactacccgcaaaaccgggtgactgac
caccggatcggcctcactttgaacaaattggaccggatcatgaacggggaactggacgaa
gtcatcgatgctttgacggtttactaccaaaccaagcaattagaggagctggcagaaaat
gcataa

DBGET integrated database retrieval system