KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0638Help
Entry
LDBND_0638        CDS       T01360                                 

Definition
(GenBank) ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00190  Oxidative phosphorylation
lde01100  Metabolic pathways
Module
lde_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LDBND_0638
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:lde00194]
    LDBND_0638
Photosynthesis proteins [BR:lde00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   LDBND_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B Mt_ATP-synt_B Hph Neur_chan_memb DUF3552 V_ATPase_I
Motif
Other DBs
NCBI-ProteinID: ADQ60685
Position
643376..643882
Genome map
AA seq 168 aa AA seqDB search
MEFQPVFAGAEISIINTLWYLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASD
RKKAEILANEREAALKNSRQEATQILSVAKSNAQKTGKQIVSEAKAEASAIRERAKADAA
QAKSDALNEARNEVADLSVTIAEKVIAKNLSAADQKDLVDQFIKGLND
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaaccagtattcgccggcgctgaaatctcaatcattaataccctttggtat
ttaatagtattcagtatccttttgctggccgtcaagcattatgcctggggcccggtaaag
gacatgatggagaagcgccgtcagaaagtcattgatgacttggatcaagctgctagcgac
cgcaagaaggctgaaattttggccaatgaacgggaagcagccttgaagaattcaagacaa
gaagcaacccagatcctctctgttgccaagagtaatgcgcaaaagaccggcaagcaaatc
gtcagcgaagccaaggctgaagcttccgctatccgggaaagggccaaggctgatgcagcg
caagctaaaagtgacgccttgaacgaagcccgcaacgaagtcgctgatctttctgtgacg
attgcggaaaaggtaattgctaagaacttatctgctgctgatcaaaaagatttagttgat
cagttcattaaggggttgaacgattaa

DBGET integrated database retrieval system