KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0640Help
Entry
LDBND_0640        CDS       T01360                                 

Gene name
atpA
Definition
(GenBank) ATP synthase subunit alpha
  KO
K02111  F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00190  Oxidative phosphorylation
lde01100  Metabolic pathways
Module
lde_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LDBND_0640 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:lde00194]
    LDBND_0640 (atpA)
Enzymes [BR:lde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     LDBND_0640 (atpA)
Photosynthesis proteins [BR:lde00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   LDBND_0640 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ADQ60687
Position
644447..645958
Genome map
AA seq 503 aa AA seqDB search
MSIKAEEISSLIKQQLEHYDDKLDIEEVGVVTYVGDGIARAHGLNNVLSSELLQFDNGAY
GIAQNLESNDVGIIILGKFDDIREGDRVKRTGRIMEVPVGDALIGRVVNPLGQPVDGLGE
IKTDKTRPIESKAPGVMQRQSVNQPLQTGIKAIDALVPIGRGQRELVIGDRKTGKTSLAI
DTILNQKGQDVICIYVSIGQKESTVRAQVETLKKLGAMDYTIVVEAGPSEPAPMLYIAPY
SGTAMGEEFMYAGKDVLVVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
SAKLSKELGGGSLTALPFIQTEAGDISAYIPTNVISITDGQIFLQSDLFFSGTRPAIDAG
ASVSRVGGAAQIPAMKKVAGTLRTDLASYRELESFAQFGSDLDQATQAKLARGRRTVEVL
KQPLHKLVAVEKQVVLLYALTHGFMDAVPVDDIARFEQELYTDFDANHADLLAEIKSTGK
LPDENKLQEALQQFASSFSSSNK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttgagcattaaagcggaagaaatcagctctttaatcaagcagcaacttgaacactacgac
gataagctggacatcgaggaagtcggtgtcgtaacttacgtcggcgatggtatcgcccgc
gctcacggcttgaacaatgtcttgtcaagtgagcttttgcagttcgacaatggtgcctac
ggtatcgcccaaaacttggaaagcaatgatgtcggtatcatcattctgggcaagtttgac
gacatccgtgaaggcgaccgcgtgaagcgaactggccggattatggaagttccagttggg
gatgctttgattggccgggttgtgaatccacttggccagccagttgacggcttaggcgaa
atcaagactgacaagactcgaccaatcgagtcaaaggcgccaggcgttatgcagcgtcag
tcagttaaccagcctttgcaaactggtattaaggccattgatgcgctggtgccaattggc
cgtggtcagcgtgagctggtcattggtgaccgtaagactggtaagaccagtttagcgatc
gacaccattttgaatcaaaaagggcaggacgtaatttgtatttacgtctcaattggtcaa
aaggaatcaactgtcagagcacaagttgaaaccttgaagaagcttggggcgatggactac
accatcgtggttgaagctggtccttcagaaccggcaccaatgctttacatcgcgccatat
tccgggaccgcgatgggggaagaattcatgtacgccggcaaggacgtcctggttgtcttt
gacgacttgtccaagcaggcggttgcctaccgtgaactttccctgctgcttcgccggcca
cctggccgtgaagcctacccaggtgacgtcttctacctgcactcacgtttgttggaacgg
agtgccaagctgagcaaggaactgggcggcggctcattgactgccttgccattcattcag
actgaagccggggacatctccgcctacattccaaccaacgttatttccatcactgacgga
cagatcttcttgcaaagtgacctgttcttctccggtacgcgcccagccatcgacgccggg
gcttctgtttcccgtgtcggcggggccgcgcagatcccagccatgaagaaggttgctggt
actttgcggaccgacctggcttcataccgggaactggaaagctttgcccagttcggcagt
gacctggaccaggcaacgcaagccaagctggcccgcggccggcggaccgtcgaagtattg
aagcagccgctgcacaagctggttgccgttgaaaagcaggttgtcctgctttacgctttg
acccatggctttatggacgcggtgccagtcgatgatattgctcgctttgaacaagaactt
tacaccgactttgacgccaaccatgctgatctgttagctgaaatcaagtcaactggcaaa
ttgccagatgaaaacaagcttcaagaagctcttcaacaatttgcatccagcttttcatca
agtaacaaatag

DBGET integrated database retrieval system