KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0642Help
Entry
LDBND_0642        CDS       T01360                                 

Definition
(GenBank) FoF1 membrane-bound proton-translocating ATPase beta subunit
  KO
K02112  F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00190  Oxidative phosphorylation
lde01100  Metabolic pathways
Module
lde_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LDBND_0642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:lde00194]
    LDBND_0642
Enzymes [BR:lde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     LDBND_0642
Photosynthesis proteins [BR:lde00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   LDBND_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase AAA AAA_19 AAA_16 NACHT ABC_tran ATPase_2 AAA_25 RNA_helicase NB-ARC AAA_30 NTPase_1 AAA_18 TrwB_AAD_bind ATPase Roc
Motif
Other DBs
NCBI-ProteinID: ADQ60689
Position
646951..648390
Genome map
AA seq 479 aa AA seqDB search
MSQGEIVQVIGPVVDVKFPIGKDLPDINNALKVIKSDDDSIILEVTLEQGDGVLRCIAME
STDGLRRGMKVEDTGSSISVPVGPDTLGRVFNVLGQPIDGGSEFPADHPRSGIHKEAPKY
DELTTSREILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTTIIQELIHNIAQEHNGISVF
TGVGERTREGNDLYFEMKASGVLDKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQ
DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQA
VYVPADDYTDPAPATTFAHLDATTNLERSLVEQGIYPAVDPLESTSSALDPEVVGQEHYD
VATRVQHILQRYRELQDIISVLGMDELSDEEKLIVARARRIQFFLSQNFFVAEVFTGVPG
SYVPIKETIKGFKMILDGHLDDLPEDAFRGVGPIEDVLKKAQKMGVTPSDPEAKALLEK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaaggtgaaatcgttcaagtaatcggccctgttgtcgacgtcaagtttccaatt
ggcaaagacctgccagacatcaacaatgccttgaaggttatcaagtcagacgacgactcg
attatccttgaagttactcttgaacaaggcgatggcgttttgcgctgcatcgcgatggaa
tctaccgatggccttcgtcgtgggatgaaggttgaagatactgggagctcaatttccgtg
ccagttggtccggataccttgggccgggtcttcaacgttttaggtcaaccgattgatggt
ggttcagaatttccagctgaccaccctcgctccgggatccacaaagaagcacctaagtat
gatgaattaactactagccgtgaaatcctggaaaccgggatcaaagttatcgacttgttg
gaaccatatcttcgtggtggtaaggtcggtctgttcggtggtgccggggtcggcaagacc
acgatcatccaggaattgattcacaacattgcccaggaacacaacggtatttccgtcttc
accggtgtcggggaaagaacccgtgaaggtaacgacctttacttcgaaatgaaggcatct
ggcgttttagacaagaccgccatggtcttcgggcagatgaacgagccgcctggtgccaga
atgcgggtcgctttgaccggtttgacgatcgctgaatacttcagagacgttgaaggccag
gacgtgctgctcttcatcgacaatatcttccggtttacccaggccggttctgaagtttct
gccttgctgggccggattcctagtgccgttggttaccagccaactttggcaacggaaatg
ggtcaattgcaagaaagaatcacttccactaagaaggggtcaatcacctctatccaagcc
gtttacgttccagccgacgactacactgaccctgcgccagcgactactttcgcccacctg
gacgcgacgaccaacttggaacgtagcctggtagaacaaggtatctacccggccgttgac
ccacttgaatcaacttccagtgccctggaccctgaagttgtcggccaggaacactacgac
gttgcgacccgggttcagcacatcctgcaacgttaccgcgaactgcaagacatcatctcc
gttttaggtatggatgaattgtcagatgaagaaaagctgatcgttgcccgggcacgtagg
attcagttcttcctgtcacaaaacttcttcgttgccgaagtctttaccggcgttccaggc
tcatacgttccaatcaaggaaacgatcaagggcttcaagatgatcctcgacggccatctt
gacgacttgcctgaagatgccttcagaggcgttggcccgatcgaagacgttttgaagaag
gcgcaaaagatgggggttaccccaagcgatccggaagcaaaagccttattagaaaagtag

DBGET integrated database retrieval system