KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0643Help
Entry
LDBND_0643        CDS       T01360                                 

Gene name
atpC
Definition
(GenBank) H(+)-transporting ATPase F(1) epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00190  Oxidative phosphorylation
lde01100  Metabolic pathways
Module
lde_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LDBND_0643 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:lde00194]
    LDBND_0643 (atpC)
Photosynthesis proteins [BR:lde00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   LDBND_0643 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DREPP
Motif
Other DBs
NCBI-ProteinID: ADQ60690
Position
648486..648842
Genome map
AA seq 118 aa AA seqDB search
MRAIDGDRQILYNHLPILTPLTIGEVRVQRGADVDHKVDHIAVSGGIIEFANNVATIIAD
NAERARNIDLSRAEAAKQRAEALIKEAKEKHDEQLLERAQIALRRAVNRIHVYDELQK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctattgacggcgaccggcagattttgtacaaccacctgccgattttaactccg
ctgacaattggtgaagtccgggttcaacgcggtgccgatgtcgaccacaaggttgatcac
atcgccgtcagcggggggatcatcgaattcgccaacaatgtggcaacgattattgctgac
aacgcagaacgcgcgcgcaacattgacctcagtcgggctgaagctgccaagcagcgggcc
gaggcgctcatcaaggaagccaaggaaaagcacgacgagcagttattggagcgggctcaa
attgctttgcggcgggctgtaaaccggattcacgtttacgacgagctgcagaaataa

DBGET integrated database retrieval system