KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0644Help
Entry
LDBND_0644        CDS       T01360                                 

Definition
(GenBank) Predicted membrane protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1146
Motif
Other DBs
NCBI-ProteinID: ADQ60691
Position
648891..649121
Genome map
AA seq 76 aa AA seqDB search
MRQLGIHAIISLVIYFVCIALAFQAIKAVRIEKIIRTSRVFEAQVFLIFTAIALGYTVGQ
FLIALIDTSLQLSNLF
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacttggaattcacgcaatcatcagcttggtgatctactttgtttgcattgcc
ttagcctttcaggcgatcaaagccgtcagaattgagaaaatcattcggaccagccgggta
tttgaagcccaggtcttcttgatttttacggcgattgccctgggctatacggtcggccaa
tttttgatcgccttgatagatacttcattacaattgtctaacctgttttaa

DBGET integrated database retrieval system