KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0646Help
Entry
LDBND_0646        CDS       T01360                                 

Definition
(GenBank) Alpha-hemolysin family protein
  KO
K08998  uncharacterized protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    LDBND_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YidD
Motif
Other DBs
NCBI-ProteinID: ADQ60693
Position
650199..650486
Genome map
AA seq 95 aa AA seqDB search
MRQIMIILVSFYQRAISPILPDSCRFYPTCSSYMITALEKHGPLLGLLMGLARILRCNPF
NRGGVDPVPDKFTLLRNPHPEEYEDEIIARKFHSH
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaataatgattattctagtcagcttttaccagcgggcaatctcaccaattttg
ccggacagctgccgtttctacccgacctgctccagctatatgatcactgctttggaaaag
catggtccgcttttgggactgctgatgggcctggcaaggatcctgcgctgcaatcctttt
aaccgcggcggggtggatccagtaccggacaagtttacccttttgcgcaatccccaccca
gaagaatatgaggacgaaattattgccagaaaattccacagtcactaa

DBGET integrated database retrieval system