KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0651Help
Entry
LDBND_0651        CDS       T01360                                 

Definition
(GenBank) Transposase for insertion sequence element
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 Spectrin_like
Motif
Other DBs
NCBI-ProteinID: ADQ60698
Position
complement(652905..653525)
Genome map
AA seq 206 aa AA seqDB search
MEDVLDVYELPYNPKVPVVCMDEKPYQLLGEVRDSWAMRPGDNKKVDSEYVRKGTCSIFA
FVEPLGGRHHTSVREHRTAVDWAEEIKYMVDEMYPEAEKIILVMDNLNTHKPSSLYKAFK
PEEARRIIKKLEIHYTPKHGSWLDIAEIELNVMTRQCLSQRIPDIETLREELSAWESERN
NSYALVNWQFRTSDARIKLASLYPKL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgttctggatgtttatgagcttccttacaatccaaaagtgccggtagtttgc
atggatgaaaagccatatcagttgttaggcgaagtcagagactcatgggctatgcgtcca
ggtgacaataagaaagttgattcagaatacgttcgtaaaggtacatgcagtatctttgcc
ttcgtagagccgctaggaggtcgtcatcacacaagcgtcagagaacaccgaactgcagtt
gactgggctgaagaaatcaaatatatggttgatgagatgtaccctgaagccgagaagatc
attcttgtcatggacaatcttaatacgcacaagccatcctcactatataaggctttcaag
ccagaggaagcacgtcgaatcatcaagaagcttgagattcactatactcccaagcacggc
agctggttagatatcgctgaaattgagctaaatgtgatgaccagacagtgtctttctcaa
agaatcccggatattgagacactacgcgaagaattgagcgcttgggaaagtgagcggaat
aatagctatgctttggtaaactggcagtttagaacttcggatgcacgtatcaaacttgca
tctttgtatccaaagctatag

DBGET integrated database retrieval system