KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0655Help
Entry
LDBND_0655        CDS       T01360                                 

Gene name
rpsD
Definition
(GenBank) 30S ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde03010  Ribosome
Module
lde_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lde00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LDBND_0655 (rpsD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lde03011]
    LDBND_0655 (rpsD)
Ribosome [BR:lde03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    LDBND_0655 (rpsD)
  Archaea
    LDBND_0655 (rpsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4
Motif
Other DBs
NCBI-ProteinID: ADQ60702
Position
complement(656329..656940)
Genome map
AA seq 203 aa AA seqDB search
MSRYTGPSWKRSRRLGISLSGTGKELARRSYVPGQHGPNHRGRLSEYGMQLHEKQKLRWM
FGLSERQFRTLFVRAGKIREGQHGINFMILLERRLDNVVYRLGLATTREQARQLVNHGHI
TVDGKRVDIPSYEVKVGQTISLKEKSKNLQQVKDALEAVASRPSFVSFDEDKMEGQLVRF
PERDEMEPEIDEALVVEYYNKLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagatacactggtccaagttggaagcggtcaagaagattgggtatttctttgtca
ggcactggcaaggaacttgctcgtcgttcatacgttccaggtcaacacggtcctaaccac
cgcggccgtctttcagaatacggcatgcaattgcacgaaaagcaaaagctgcgctggatg
ttcggtttgagcgaacgccaattccgtactttgtttgtccgcgccggtaagatccgtgaa
ggccaacacggtatcaacttcatgatcttgcttgaacgtcgtttggacaacgttgtttac
cgtctcggcttggctactacccgtgaacaagcccgtcaattggtaaaccacggccacatc
actgttgatggcaagcgcgttgacattccttcatacgaagttaaagttggtcaaaccatt
agcttgaaggaaaagtcaaagaacctgcaacaagttaaggacgctttggaagctgttgct
tcacgtccatcatttgtttcatttgacgaagacaagatggaaggtcaattggttcgcttc
ccagaacgtgacgaaatggaaccagaaattgacgaagccctggttgttgaatactacaac
aagttgctgtaa

DBGET integrated database retrieval system