KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0659Help
Entry
LDBND_0659        CDS       T01360                                 

Definition
(GenBank) Pseudouridine synthase
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lde03009]
    LDBND_0659
Enzymes [BR:lde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     LDBND_0659
Ribosome biogenesis [BR:lde03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    LDBND_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ADQ60706
Position
661418..662143
Genome map
AA seq 241 aa AA seqDB search
MLRLDKFLANMKVGSRSQVHEIIKAGQVTVNGKVCRSAKQKVKEDAEVLVNGQAVIYQQY
HYFLLNKPAGVLSATEDSRQKTVLDLLKDQDSYQKIAPVGRLDKDTTGLLLLTNDGQLAH
QLLAPEYHVPKPYYALLAGVADEETAKAIAAGLTLKDGTELKPGQLKILRQDKDQEQSEI
EITITEGKYHQVKRMFASQGMKVLKLKRLSMGPLTLPADLAPGSYRPLTEEELAALKQVA
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctggacaaatttttggccaacatgaaggtgggctccaggtcccaggttcat
gagatcattaaggccggccaggtgacggtcaacgggaaggtctgccggtcagccaagcag
aaggtgaaagaggatgcggaagttctggttaatggccaggcagttatctaccagcaatac
cactactttttgctcaataagccagctggcgtcttgtcggcaacagaagactcccggcaa
aagaccgtcctggacctgctaaaagaccaggacagttatcaaaaaatcgctccagtgggc
cgcttggacaaggacacgaccggcctcttgcttttgaccaatgacggccaattggcccac
cagctcctggctccagaataccatgtgcctaagccctattacgcgcttttggccggagta
gccgacgaagaaacggccaaggcaattgcggcgggcctcactttaaaagatggaacggaa
ttaaagccgggccagctgaagatcttgcggcaagacaaggaccaggagcagtcagaaatc
gagatcaccattaccgaaggcaaataccaccaggtcaagcggatgtttgcctcccagggg
atgaaggtcttaaagcttaagcggctgagcatggggcctttgactttgccggctgattta
gctcctggctcttaccggcctttgacagaagaagagctggcggccttaaagcaagttgcc
ctttaa

DBGET integrated database retrieval system