KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0663Help
Entry
LDBND_0663        CDS       T01360                                 

Definition
(GenBank) Predicted sugar phosphatase of HAD family
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADQ60710
Position
666318..667013
Genome map
AA seq 231 aa AA seqDB search
MKGENMRVAGLKTDKQGVIFDMDGLLVNSEELYWQANIQAAREYKLGISDDAYLDLVGAS
VKAMDAFYEKYFPSDEVRQAFVKRTDDLVWEWTDQGKLKLKAGVKEALEHFNDLGLTVGI
ASNNYKSVVDHNLWVTGCRNSFDFIVTHDEVAEKKLRSKPFPDLYLAAQERSGLGKDQLL
IFEDSSMGVEAAENAEIDCVMIPDIKPASAEDRARAQLICSDFFDFLKKIS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggaaaatatgcgtgttgcaggtttaaagacggacaagcagggggtaattttt
gacatggacggcctcctggtcaactccgaagagctctactggcaggccaatatccaggcc
gcccgggaatacaagctgggcatcagcgatgatgcttacctggacctggttggagccagc
gtcaaggccatggatgccttttatgaaaaatattttccaagcgatgaggtccgccaggct
tttgtcaagcggaccgacgatctggtctgggaatggaccgaccagggcaagctgaagctg
aaggccggggtcaaggaggctctggagcactttaatgacctgggcttaaccgtcgggatc
gccagcaacaactataagagcgtggttgaccacaatctctgggtgaccggctgccggaac
agctttgactttatcgtcacccatgacgaagttgctgagaaaaagctccggtccaagcct
ttcccggacctctatctggctgcccaagagcgcagcggcctgggtaaagaccagctcttg
atctttgaagactccagcatgggggtcgaagcggcggaaaatgccgagattgactgcgtc
atgattcccgacatcaagcccgcttcagccgaagaccgggccagagcccagctgatttgc
tcggacttttttgactttttgaaaaaaatttcttag

DBGET integrated database retrieval system