KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0668Help
Entry
LDBND_0668        CDS       T01360                                 

Definition
(GenBank) Hypothetical protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4044 K1 CrgA
Motif
Other DBs
NCBI-ProteinID: ADQ60715
Position
complement(670269..670391)
Genome map
AA seq 40 aa AA seqDB search
MARKKKKSTFQNIKNFMVVLMALITLFGVAASVLYYLTAQ
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaaaagaaaaagtcaacatttcaaaatattaagaatttcatggtagtcttg
atggctttgatcacgctctttggcgtggcagcctctgttctttactacttaactgcccaa
taa

DBGET integrated database retrieval system