KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0669Help
Entry
LDBND_0669        CDS       T01360                                 

Definition
(GenBank) Hypothetical protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3397 PMP1_2
Motif
Other DBs
NCBI-ProteinID: ADQ60716
Position
670510..670839
Genome map
AA seq 109 aa AA seqDB search
MLMIFLLPAFGLACAYLVNLIWPKAAFKGYDVMPFFLIYACQLMTNLKGVPSFLPAGFLL
YFILILLAAIRWAMINKNISLGKMFRQFWSYLDACSFFWYCGLLLVVMI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgatattcttattgccggcctttggcctggcttgcgcctacctggtcaacctg
atctggcctaaagccgcctttaaaggctatgatgtcatgcctttttttttgatctacgcc
tgccagctgatgaccaacttaaagggcgtgccatcctttttaccggccggctttttgctt
tacttcatattgatattgctggccgccatcagatgggccatgatcaacaagaacatttcc
ttagggaagatgttccgccagttctggtcctacctggatgcctgcagtttcttttggtat
tgcggattgcttttggtcgttatgatctga

DBGET integrated database retrieval system