KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0671Help
Entry
LDBND_0671        CDS       T01360                                 

Gene name
mraW
Definition
(GenBank) S-adenosyl-L-methionine-dependent methyltransferase mraW
  KO
K03438  16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lde03009]
    LDBND_0671 (mraW)
Enzymes [BR:lde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.199  16S rRNA (cytosine1402-N4)-methyltransferase
     LDBND_0671 (mraW)
Ribosome biogenesis [BR:lde03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    LDBND_0671 (mraW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_5 Methyltransf_25 MTS Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ADQ60718
Position
671405..672349
Genome map
AA seq 314 aa AA seqDB search
MEFKHTSVLLHETIDNLAPQSGGTYVDATFGGGGHARYLLSKLDKGNLIGFDQDQYAIDT
AQSNFAAFLKEDSQPRLQLVHNNFSHLKEELAKLGISGIDGIYYDLGVSSPQLDQAERGF
SYRFDARLDMRMDQSQDFDAYQLVNQYDQKQLADVLYRYGDEKFSRQIARKIVERRRVKP
IETTFELVEIIKEAIPAAARRSGGHPAKKSFQAIRVEVNHELDVLRASLEEAISLLNPGG
RISVITFQSLEDKIVKQTFKKYSEVEIPRGMPVVPEGIKPTLRLVNRKPITASEEELAEN
NRSHSAKLRVAEKL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaagcatactagcgtgttattgcacgaaacaatcgacaacctggccccacaa
agcggcggcacatatgtggatgccaccttcggcgggggcgggcatgcaagatacctgctt
agtaagctggacaaaggaaatctaatcggtttcgaccaggaccagtacgcgattgacacc
gcccagagcaattttgctgcctttttaaaagaagacagccagccccgcctgcagctggtt
cacaacaacttcagccacttaaaagaggagctggccaagctggggattagcggcattgac
ggcatctactacgacttgggtgtttcatctccgcaattggaccaggctgaacgtggtttt
tcctaccgttttgacgcaaggctggacatgcggatggaccagagccaggactttgatgct
taccagctagtcaaccagtatgaccaaaagcagctggctgacgtcctttaccgctacggc
gatgagaagttttcccggcagatcgccagaaagatcgttgaaagaagacgggtcaagccg
attgaaactacttttgagttagtggagatcattaaggaagcaattccggcagcagcccgc
cgcagcggcggccacccggccaagaagagcttccaggccatccgggtggaagtcaaccac
gagctggacgttttgcgggcatctttggaagaagccatcagcctgctcaatcccggcggc
cggatctccgtcatcaccttccagtctttggaagacaagatcgtcaagcagaccttcaag
aagtattcagaagttgaaattccccgcgggatgccggttgtgcccgaggggatcaagcca
actttacgcctggtcaaccgcaagccgattacggccagcgaggaagaactggcggaaaac
aaccgatcacacagtgcaaagttaagagtagcagagaagttataa

DBGET integrated database retrieval system