KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0675Help
Entry
LDBND_0675        CDS       T01360                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00471  D-Glutamine and D-glutamate metabolism
lde00550  Peptidoglycan biosynthesis
lde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LDBND_0675 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LDBND_0675 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lde01011]
    LDBND_0675 (murD)
Enzymes [BR:lde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LDBND_0675 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lde01011]
 Precursor biosynthesis
  Amino acid ligase
   LDBND_0675 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Peripla_BP_6 Peripla_BP_4 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADQ60722
Position
675856..677238
Genome map
AA seq 460 aa AA seqDB search
MKEIDKYAGKNILVLGLGRSGFAVSKLLLKLGARLTLNDKADLAADPKAKQLADLGVRVI
GGSHPVDLFDQEKFDYLVKNPGIPYENPMVAKASEKGVPIITEPEVALSASESPYVCVTG
SNGKTTTVMLTQQIMDHYLQKQGHHAYAVGNIGWPISEVVLNQAGPDDLLVVEMSSFQLM
GVTDIEPKVAAIVDIYNNVHLDYHKTFDNYVDAKLNVCRFQKASDYFLANFDQKDILTRE
EKATKAKILTFSENDPAADFYIGQDYLMHGEEKMMKIADIKLPGIHNLQNSLVAIGISSL
MGAGKDDIAAVLSTFTGAEHRLQYVTTLDGVKVYNDSKSTNIEAATVAIQSFKQPEVLLA
GGLDRGFVFDSLVDLFKKHVKAIVTYGETRYLLADAARKAGIKTIVVVDNLHEGVKAASK
LAEAGDVLLFSPACASWDQFKTFEERGEYFVKYVKELEEK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatcgataaatatgctggtaaaaacattcttgttttaggtctgggccggagc
ggcttcgcggtcagcaagctgctccttaagctgggcgcgcgtttgactttaaacgacaag
gccgacttggctgctgacccgaaggctaagcagttagctgacctgggcgtcagagtaatt
ggcggcagccacccggttgacctgtttgaccaagaaaagtttgactacctggttaaaaac
cccggcatcccttacgagaacccgatggtggctaaggccagcgaaaaaggggttccgatc
atcactgaacctgaagttgctttaagcgccagtgagtcgccttatgtctgcgtcactggt
tcaaacggcaagaccaccacggtcatgctgacccagcagatcatggatcactacctgcaa
aagcagggccaccacgcttacgcggtcggcaacatcggctggccgatttctgaagtagtt
ttaaaccaggccggcccagacgacctgctggtcgtggaaatgtccagcttccagctgatg
ggggtaaccgacattgagccaaaggtagccgccatcgttgacatctataacaatgtccac
ctggactaccacaagacttttgataactatgttgacgccaagctgaacgtttgccgcttc
caaaaggccagcgactacttcctggccaactttgaccaaaaggatatcctgactagagaa
gaaaaggcaactaaggctaagattctgaccttcagtgaaaatgatccagctgcagacttc
tacattggccaggactacttgatgcatggcgaagaaaagatgatgaagattgccgacatc
aagctgccggggatccacaatttgcaaaactccctggttgccatcggcatcagcagcctg
atgggggcgggcaaggacgacatcgcggccgttttgtccaccttcaccggggctgaacac
cgcctgcagtacgtgaccacccttgacggggtcaaggtctacaatgactccaagtcaacc
aacattgaagcagccaccgtggccatccagtccttcaagcagccggaagtccttttggcc
gggggcctggaccggggctttgtctttgattccctggttgatctgtttaaaaagcacgtc
aaggccatcgtaacttacggggaaacccgttacctgctggcggacgcggccagaaaggcc
ggaatcaagaccatcgtggtcgttgacaacctgcacgaaggggttaaggcagcatccaag
ctggctgaagccggcgacgtcctgctcttttcaccggcctgcgcttcctgggaccagttc
aagacctttgaagaacgcggcgaatattttgtcaagtatgtaaaagaattggaagagaaa
taa

DBGET integrated database retrieval system