KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0679Help
Entry
LDBND_0679        CDS       T01360                                 

Definition
(GenBank) Cell division protein ftsZ
  KO
K03531  cell division protein FtsZ
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lde03036]
    LDBND_0679
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lde04812]
    LDBND_0679
   02048 Prokaryotic Defense System [BR:lde02048]
    LDBND_0679
Chromosome and associated proteins [BR:lde03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LDBND_0679
Cytoskeleton proteins [BR:lde04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   LDBND_0679
Prokaryotic defense system [BR:lde02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    LDBND_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C
Motif
Other DBs
NCBI-ProteinID: ADQ60726
Position
680678..682036
Genome map
AA seq 452 aa AA seqDB search
MALDFTFDSDDNNNAVIKVIGVGGAGGNAVNRMIEDGVQGVSFIAANTDVQALNSNNAEV
KIQLGPKLTRGLGAGSHPETGQKAAEESEETIEDALKGADMIFITAGMGGGTGTGAAPVI
AKIARETGALTVGVVTRPFSFEGPKRSKNAAEGIAKLKEYVDTLVIVANNRLLEIVDKKT
PMMEAFKEADNVLKQGVQGISDLITSTDYVNLDFADVKTVMENQGAALMGIGRASGENRT
VEATKMAISSPLLEVSIDGAKQVLLNITGGPDLTLFEAQDASEIVSTAAGEDVNIIFGTA
INPNLGDEVVVTVIATGIDDEAEAAASKQLPGRGHQVSAPREKPAAPKILTPEEAAPAAP
VQEAPVQAEAAKPTSPVKEEKPAMMDPISVWGLNDDDYSRRQNPEEQKRQAEEKEAASDA
DPSSAISQIDINTDYDDDDDDDIPFFKHRRDR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctttggattttacttttgattcagatgacaacaacaacgcagttatcaaagtaatt
ggcgttggcggggcaggcggcaatgccgtcaaccggatgattgaagacggcgttcaaggc
gtctcttttatcgcggccaacactgatgtacaggctttgaacagcaacaacgctgaagtt
aagattcagctggggccgaaactgaccaggggcttgggggcaggttcacatcctgaaacc
gggcaaaaggccgctgaagaaagcgaagaaacgattgaagacgcacttaagggtgctgac
atgattttcatcactgccggcatgggcggtggtactggtaccggggctgccccggtaatc
gccaaaattgcccgggaaaccggtgctttgacggttggggtggttacccgtccattcagc
tttgaaggccctaagcggtccaagaacgccgctgaggggattgccaagctgaaggaatac
gttgacaccctggtcatcgttgccaacaaccggcttttggaaatcgttgacaagaagaca
ccgatgatggaagcattcaaggaagccgacaacgtcctcaagcagggtgtccagggcatt
tccgacttgatcacttcaactgactacgtgaacctggactttgctgacgtcaagacggtc
atggaaaaccagggggcagccttgatgggaatcggccgggccagcggcgaaaaccggaca
gtggaagcaaccaagatggcgatttcctcaccgcttttggaagtttccatcgacggggcc
aagcaggtcctcttgaacatcactggcggtccggacttgaccctgtttgaagctcaggat
gcttcagaaatcgtttcaacggctgccggcgaagatgtcaacatcatcttcggtacggcc
atcaaccctaacctgggcgatgaagtcgtggttacggtgatcgctaccgggattgatgac
gaagctgaagcagctgcttccaagcaattgccaggccgcggccaccaagtgagtgcgcct
agagaaaagccagctgcgcctaagatcttgactccggaagaagctgctccagctgctcca
gtacaagaagcgccagttcaagctgaagcagctaagccgaccagcccggtcaaggaagag
aagccagccatgatggacccgatcagcgtttggggcctcaacgacgatgactactcaaga
cggcaaaacccggaagaacaaaagcggcaggctgaagaaaaggaagcggcttcggatgct
gacccaagcagcgccatttcccaaattgacatcaacaccgattacgacgacgatgatgac
gacgatattccgttcttcaagcaccgccgggaccggtaa

DBGET integrated database retrieval system