KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0683Help
Entry
LDBND_0683        CDS       T01360                                 

Gene name
ileS
Definition
(GenBank) Isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00970  Aminoacyl-tRNA biosynthesis
Module
lde_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lde00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LDBND_0683 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lde01007]
    LDBND_0683 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lde03016]
    LDBND_0683 (ileS)
Enzymes [BR:lde01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     LDBND_0683 (ileS)
Amino acid related enzymes [BR:lde01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LDBND_0683 (ileS)
Transfer RNA biogenesis [BR:lde03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LDBND_0683 (ileS)
 Prokaryotic Type
   Other AARSs
    LDBND_0683 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e zf-FPG_IleRS tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADQ60730
Position
683913..686708
Genome map
AA seq 931 aa AA seqDB search
MRVKDTLNLGKTKFPMRGNLPKREAEWEKNWEDQKFYERRLKLNEGHERFDLHDGPPFAN
GNIHMGHALNKITKDIIVRSKNMEGYYAPYVPGWDTHGLPIEQQLTKQGVDRKTMDRAAY
RELCWKFAMEQVEKQRTDFKRLGVMGDWDHPYITLLPEFEAAEIRIFGKMYENGYIYQGK
KPVYWSWSSESTLAEAEVEYHDVESPSIYISFPVKDGKGKLSEENTYFLIWTTTPWTIPS
NQGIAVNPKFDYSVVEVGDRRYVVGTDRLSAVAEILGWDSYKTVQHLKGTDMEYMVAKHP
YIEGRDSLLMEAVYVTDDDGTGLVHTASGFGEDDYNTAMRYGFDVLSPMDNKGCFTEEIP
DPDLVGKFYADTNEIVKDKLAAAGNLLHYSTFVHSAAHDWRTKKPVVYRATTQWFASISK
FRDQILDQIEKATFYPAWGKTRLYNMIKDRGDWVISRQRAWGVPLPIFYAEDGTAIVTHE
TIEHVADLFAKEGSNAWFTHPVEELLPEGFTSEHSPNGKFTKETDILDVWFDSGSSWSGV
QALGRDVHYPTSMYLEGSDQYRGWFNSSLITSVATNGVAPYKSVLSQGFTLDGQGRKMSK
SLGNTIAPNDVIKQMGAEIIRLWVASVDASGDVGVSMDILRQVSEGYRKIRNTFRYMLAN
TADFDPEKDRVAYKDLRKIDQYLEVKLNDLVAESIVNYDKYDFADVYKLVFKFITNDLSA
FYLDFAKDVLYIEGKDSHARRSMQTVIYDAAVKLAKILAPILPHTMGEVWGYLKEKEEDV
YLSNFPEIEDYADADDLKESWGEFMKLRDDVLKALEEARDQKLIGKSFEASVTVYPGEAA
KAALDKLAGEDFREILIVSNLVMGQGEVPAEAKQFDQASVLVRRAEGEVCPRCRMYRTDL
GADSRLPQLCGRCASIVAGDHPEILEEGLED
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttaaggatacgctgaacctgggcaagaccaagttcccaatgcggggcaacctg
cccaagcgggaagcagaatgggaaaagaactgggaagaccagaagttttatgaaagacgc
ttgaagcttaacgaaggccatgaaagatttgaccttcacgacggacctccatttgccaac
ggcaacattcacatgggccacgccttgaacaagatcaccaaggacatcatcgtccggagc
aagaacatggaaggctactacgctccttacgttccgggctgggatacccacggcctgcca
attgagcagcaattgaccaagcagggcgttgaccgcaagactatggaccgggctgcttac
cgggaattgtgctggaagtttgctatggagcaggttgaaaagcagcggaccgacttcaag
cgcctgggcgttatgggcgactgggaccacccttacatcacccttttgccggaatttgaa
gccgcagaaatccggatcttcggcaagatgtacgaaaatggctacatctaccaaggcaag
aagccggtttactggtcctggtccagtgaatcaactttggcggaagcagaagtcgaatac
cacgacgtggaatcaccatcaatttacatttccttcccggtcaaggacggcaagggcaag
ctgagtgaagaaaacacctacttcctgatctggacgaccacgccatggactattccttcc
aaccaagggattgccgttaacccgaagtttgactactcagttgttgaagttggcgaccgc
cgttacgttgtcggtactgaccgcttgagcgccgtagccgaaatcttgggctgggacagc
tacaagactgttcagcaccttaaggggacggacatggaatacatggtggccaagcaccct
tacatcgaaggccgcgacagccttttgatggaagctgtctacgttactgacgatgatggt
accggcctggtccacaccgcttccggctttggtgaagacgactacaacactgccatgcgc
tacggctttgacgttttgtccccaatggacaacaaaggctgcttcactgaagaaatccct
gacccggacctggtgggcaagttctacgctgacaccaacgaaatcgtcaaggacaagctg
gcggctgccggcaaccttttgcactacagcacctttgtccactccgccgctcacgactgg
cggaccaagaagccggtagtctaccgggcaaccacgcaatggtttgcctcaatctccaag
ttcagagaccagatcctggaccagattgaaaaggccaccttctacccggcctggggcaag
acccgcctttacaacatgatcaaggaccggggcgattgggtaatttcccgccaacgtgcc
tggggcgtgcctttgccaatcttctacgctgaagacggcaccgccatcgtgacgcatgaa
accatcgaacacgtggctgacctctttgccaaggaaggctccaacgcctggttcacccac
ccggttgaagaacttttgccagaaggctttacttcagaacactcaccaaatggcaagttc
accaaggaaactgacatcctggacgtttggtttgactccgggtcatcctggagcggggtc
caggctctgggcagagacgttcactacccgacttccatgtacctggaaggcagtgaccaa
taccggggctggttcaactccagtttgatcaccagcgtggctaccaacggggtagctcct
tacaagtcagtcctgtctcaaggctttactttggacgggcaagggcggaagatgtccaag
tcattgggcaacacgatcgctcctaacgatgtcatcaagcaaatgggggccgaaatcatc
cgcctctgggttgcttccgttgacgcttccggcgacgtcggcgtgtcaatggacatcctg
cgccaggtttcagaaggctaccggaagatcagaaacaccttccgctacatgctggccaac
acggctgactttgatccggaaaaggaccgggtggcttacaaggacctgcgcaagatcgac
cagtacctggaagtcaagcttaacgacttagttgccgaaagcattgtcaactacgacaag
tatgacttcgctgacgtctacaagctggtcttcaagttcatcaccaacgacctgtccgcc
ttctacctggactttgccaaggatgtcctttacatcgaaggcaaggacagccacgcccgc
cggtcaatgcagacggtgatctacgatgccgctgtcaagctggccaagatcctggcacca
attttgccgcacaccatgggcgaagtttggggctacttgaaggaaaaggaagaagacgtc
tacctgtccaacttccctgaaatcgaagactacgctgacgctgacgacttgaaggaaagc
tggggcgaattcatgaagctccgcgacgatgttttgaaggctctggaagaagcccgggac
caaaagctgatcgggaagtcctttgaagccagcgtaacggtttacccaggcgaagcagcc
aaggctgccttggacaagctggctggggaagacttccgggaaatcttgatcgtgtccaac
ctggtcatgggccaaggggaagtaccggctgaagccaagcaatttgaccaggccagcgta
cttgtccgccgggccgaaggcgaagtctgcccacgctgccggatgtaccggactgacctg
ggcgctgacagccgtttgccgcaactgtgcggccgctgcgcatctatcgtggccggcgac
cacccggaaatacttgaagaaggcctggaagactaa

DBGET integrated database retrieval system