KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0687Help
Entry
LDBND_0687        CDS       T01360                                 

Definition
(GenBank) Methylthioadenosine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00270  Cysteine and methionine metabolism
lde01100  Metabolic pathways
lde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LDBND_0687
Enzymes [BR:lde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     LDBND_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 Blo-t-5 KR NIF3
Motif
Other DBs
NCBI-ProteinID: ADQ60734
Position
687732..688430
Genome map
AA seq 232 aa AA seqDB search
MKIAIVVPMAEEAEFYHQYFSSGKKEMFGSTEFEHFSVAGNDLYLGLTGIGKVQAAMNLT
SLLAKEKIDLVIMTGSAGSLQKEVQRMDLVLPSEFAYHDAHNTSAGNYVEGQIPQEPARF
KLDCAERDKFKDFLGKKGVAYKEGLVVTGDSFISSQAQKDEILGNFPTALCVEMEGAAFA
QVAYHFNVPLIALRAISDNGDEDADNDFAAFVRKVGAQAAELIVEYLRENDF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcaatcgttgttccaatggctgaagaagctgaattttatcatcaatacttt
tcctcaggtaaaaaagaaatgttcggttcaacggaattcgaacatttttccgttgccggc
aacgatctttacctgggcttgaccgggatcggcaaggtccaggcggccatgaacctgacc
agcctcctggccaaggaaaagatcgacctggtcatcatgaccgggtcggcagggtccttg
caaaaagaagttcagcggatggacctggttttaccaagcgaattcgcctaccacgatgcc
cacaacacttcagcgggcaactatgtcgaaggacagatcccgcaggaaccggcccgcttt
aagctggactgcgcggaaagagacaagttcaaggactttttgggcaaaaagggcgtggcc
tacaaggaaggcttggtcgtgaccggggattccttcatctcctctcaggcacaaaaagac
gaaattctgggcaatttcccaaccgccctgtgcgtggaaatggagggggcagcctttgcc
caagtggcctaccactttaacgttccgctgatcgccttgcgggccatctccgacaatggg
gatgaagatgctgacaacgattttgcagcctttgtcagaaaggtcggtgcccaggcggca
gaactgatcgtggaatacttaagggagaatgatttttaa

DBGET integrated database retrieval system