KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0808Help
Entry
LDBND_0808        CDS       T01360                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00071  Fatty acid degradation
lde00072  Synthesis and degradation of ketone bodies
lde00280  Valine, leucine and isoleucine degradation
lde00310  Lysine degradation
lde00362  Benzoate degradation
lde00620  Pyruvate metabolism
lde00630  Glyoxylate and dicarboxylate metabolism
lde00640  Propanoate metabolism
lde00650  Butanoate metabolism
lde00900  Terpenoid backbone biosynthesis
lde01100  Metabolic pathways
lde01110  Biosynthesis of secondary metabolites
lde01120  Microbial metabolism in diverse environments
lde01130  Biosynthesis of antibiotics
lde01200  Carbon metabolism
lde01212  Fatty acid metabolism
lde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LDBND_0808
   00630 Glyoxylate and dicarboxylate metabolism
    LDBND_0808
   00640 Propanoate metabolism
    LDBND_0808
   00650 Butanoate metabolism
    LDBND_0808
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LDBND_0808
   00072 Synthesis and degradation of ketone bodies
    LDBND_0808
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LDBND_0808
   00310 Lysine degradation
    LDBND_0808
   00380 Tryptophan metabolism
    LDBND_0808
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LDBND_0808
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LDBND_0808
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LDBND_0808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lde04147]
    LDBND_0808
Enzymes [BR:lde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LDBND_0808
Exosome [BR:lde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LDBND_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADQ60853
Position
826139..827239
Genome map
AA seq 366 aa AA seqDB search
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALRGALKEAGLDAEALDALFMGNVLSAG
LGQNMARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTN
APKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFAD
EIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVA
EYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLA
VARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIA
FEIEKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttatattgttgcggccaagcgaactccatttggccgttaccacaagcaa
ttggctgacttttccgccatcgacctgggccaaattgccctgcgcggcgcattaaaagaa
gccggccttgacgccgaagccctggacgccctcttcatgggcaatgtcctgtctgccggc
ttaggccaaaacatggcccggcaaattgctttaaacgccgggatgcggcaggactcagtc
gccgtgtccatcaacgaagtctgcggctccagcctcaaggctgcccgcctggctgaagcc
caaatgttaatcggtgacctgggcctggttgctgtcggcggcagcgaaagcatgaccaac
gccccaaaggaaatcatgttcagcgatggactcgttgactccttctccggtaaatccatg
ggcattactgccgaaaacgtagctaagcgcaaccacatcagccgccaagacgctgacgcc
ttcagcttgtcttcccatcaaaaagctgtcaaggcacaagctgaaggactttttgccgat
gaaatcattcaaattgaagatctcaagcaagatgaaaacgttcgcccggataccagcctg
gaagccctggccggtcttaaaacttccttcctcgaagacggaaccgtcactgccggtaac
gcctccccaatctccgacggggccagcatgatcatcctggctaccgcggaaaaagtcgct
gaataccagctgacgcctttagccaagctgggtgcttacgccgaagtaggctatgacccg
gaatttatgggctatggtccatactatgctatccgtaagctgcttaatgaaactggccgg
caggtagccgattacgacttctttgaaatcaacgaagcctttgctgcaactactttggct
gttgcccgcgacctggaaattcctttagccaaggtcaacaagcagggcggggcgatcgct
ttaggccacccgctcggcgcttccggcacccgccttctggctaccgctgcccgccagctg
caaagaggcggccagcgcgctatagccagcctctgcatcgggggcggcttggccatcgct
tttgaaattgagaaggcataa

DBGET integrated database retrieval system