KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0809Help
Entry
LDBND_0809        CDS       T01360                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00900  Terpenoid backbone biosynthesis
lde01110  Biosynthesis of secondary metabolites
lde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LDBND_0809
Enzymes [BR:lde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LDBND_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red DUF2835 PhdYeFM_antitox
Motif
Other DBs
NCBI-ProteinID: ADQ60854
Position
827242..828468
Genome map
AA seq 408 aa AA seqDB search
MKFYQLPPEERRQFLQEDGVALEDIPAADLARLDEMSENVVGEVKLPLSCLTSALVNGKN
WRIPMTTEEASVVAAANHGMSVFAKAGGVKATSQRDGIYGQIVLEVTEAFSLADFKNKFP
AYIKEANKEFASLIRHGGGLKDLTARQEADLVYLLALVDPAEAMGANKTNAILEFLAQKM
LAFPGVEAKLFAILSNYPSQLTTAKVAIPVSLLSKKGDLAEGREVAKKMALLAKIGSSDP
YRAVTNNKGIMNGVDAVMLATGNDYRAVEAACHAYAAKSGQYRSLSSWKLEGENLLGQVT
LPLALGVVGGSISSRPDIRQSYAILGKIKAAELAELTASVALANNFAALNAISTKGIQAG
HMRLQSRNVVQTLPAAAEEKEAVYQMMISQGKYGETAAKNFLKELRGQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctatcagttgccgcccgaagagaggcggcagtttttgcaagaagatggggtc
gccctggaagatatccctgcagctgatttagcccgtctggatgagatgagcgaaaacgtg
gttggtgaggtcaagctccccttgagctgtttgaccagcgccctggtcaatggcaaaaat
tggcggatccccatgacgactgaagaagcctccgtcgtcgccgccgccaaccacggcatg
tccgtcttcgctaaagccggcggcgtaaaagcgaccagccagcgcgacggcatctacggg
caaatcgtcttagaagtcacggaagctttttccctggctgactttaaaaataaattcccg
gcctatattaaggaagccaacaaggaatttgccagcttgatccggcacgggggcggctta
aaagacctgaccgcccgccaggaagctgacctggtctaccttctggccctggttgacccg
gctgaagccatgggggccaacaagaccaatgctatcctggaattcctggcccagaagatg
ctggcctttcctggtgttgaagctaagctcttcgccatcctgtccaactatcccagccag
ctgactacagctaaggtggcaattcctgttagcctcctcagtaaaaaaggagacctagca
gaaggcagggaggtggccaaaaagatggccctgctggctaaaatcgggagtagcgaccct
taccgggctgtaaccaataacaaggggatcatgaatggggtagacgctgttatgctggcg
accggcaatgactaccgggcagttgaagcagcctgccatgcctacgccgccaaaagcggc
cagtatcgcagcctcagctcctggaaactggagggggaaaatctccttggccaagtcacc
ctgcccctggccttaggggtagtcggcggctccatttcatcgcggcctgatattagacaa
agctatgccattttaggtaaaataaaagcagctgaattggcagaactgaccgccagcgtc
gccctggccaacaacttcgcggccctgaatgctatctccaccaaggggatccaggctggc
cacatgcgcctgcagagccgcaacgtggttcagaccctgccggcagcagcggaagaaaaa
gaagctgtttatcaaatgatgattagccagggaaagtatggcgaaacagcagctaagaat
tttttgaaagaattgcgaggacaataa

DBGET integrated database retrieval system