KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0915Help
Entry
LDBND_0915        CDS       T01360                                 

Definition
(GenBank) Pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Brite
KEGG Orthology (KO) [BR:lde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lde03009]
    LDBND_0915
Enzymes [BR:lde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LDBND_0915
Ribosome biogenesis [BR:lde03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LDBND_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Ub-Mut7C S4_2
Motif
Other DBs
NCBI-ProteinID: ADQ60958
Position
946153..947067
Genome map
AA seq 304 aa AA seqDB search
MNREYELTAEESGQRLDKYLAGEMTDLSRSRIKELVQAGEVLVNGKKSKVSYKVQKGDLI
QVTVLPLEPLKLEAENIPLDIVYEDEDIIVVNKPQGMVVHPAAGHPSHTLVNALLYHTRD
LADSPEGFRPGIVHRIDKDTSGLLMVAKNAAARESLEKQLAAKSNKRQYLAIVHGNFAEE
EGTIDAPIGRNPKDRKQMAVVEKGKSAVTHFKVLEQYQGYSLVECQLETGRTHQIRVHMA
YIGHPLAGDPLYGPRKTLPGHGQFLHAKTLGFEQPSTGEWLEFSVQPPEIFQQTVADLRK
KRVK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgagtatgaactgaccgcggaagaaagcggccagcggctggacaagtatctg
gcaggggaaatgactgacctgtccagaagccggatcaaggaattggtccaagccggggaa
gtcctggtcaatggcaaaaagagcaaagtttcatataaagtgcagaaaggtgacctgatc
caggtcaccgttttgccgctagagccattaaagctggaagcggaaaatattccactggac
attgtctatgaagacgaagacatcatcgtggtcaacaagccgcaggggatggtggtccac
ccggccgccggccaccccagccacactttggttaacgccttgctctaccacaccagggat
ctggccgacagtccggaaggcttcagacccgggatcgttcaccggatcgacaaggacacc
tcgggcctcttgatggtggcgaaaaacgcggctgcccgggaatcactggaaaagcagctg
gccgccaaatccaacaagcgccagtacctggccatcgtccatggcaattttgcggaagaa
gaagggacaattgacgccccgatcggccgcaatcccaaggaccgcaagcagatggcggtg
gtggaaaagggcaagagcgcggtaacccactttaaggtcctggagcaataccagggctac
agcttggttgagtgccagctggaaaccggccggacccaccagatccgagtccatatggct
tatatcggccaccctttagcaggcgatcccttgtatggaccgagaaagaccctgcccggc
catggccagttcctgcatgccaagaccctgggctttgagcagccatcaacaggtgagtgg
ctagagttctccgtccagccgccggaaattttccagcagacggttgcagacttgcgaaag
aagcgggtgaaatag

DBGET integrated database retrieval system