KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1498Help
Entry
LDBND_1498        CDS       T01360                                 

Definition
(GenBank) Predicted sugar phosphatase of the HAD superfamily
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00627  Aminobenzoate degradation
lde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lde00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LDBND_1498
Enzymes [BR:lde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LDBND_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ADQ61525
Position
complement(1553878..1554648)
Genome map
AA seq 256 aa AA seqDB search
MKDYRLFLIDLDGTIYRGKETIESGVRFVKRLDEAGLDYLFLTNNTTRTPQMVADKLAGH
GVKTDVSKIYTPSMATASYILEKDAKRPIGVYIIGQIGLWKEILDRLEFYYDEENPDYVI
VGMDTDLTYHKLMVATRCIHRGAVFIGTNSDQNLPVGKELRPGNGSICAALEVASGQKPL
FIGKPEAIIVNRALDLAGVRAEEALIVGDNYPTDIMAGINSGVDTLLTLTGVTQKADLAG
LTPPTYLVNDLDEFSL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagattaccgcttatttttgattgatttggacgggaccatttaccggggcaaggag
accattgaatccggcgtccgctttgtcaagcgcctggatgaggcaggtcttgattactta
tttttgaccaacaacacgacccggacgccccagatggtagctgacaaactggccgggcac
ggagtcaagaccgacgtttccaagatctacacgcccagcatggccacggccagctatatt
ttggaaaaagatgcgaaaaggccaatcggcgtctacatcattggccaaattggcctgtgg
aaggagatcctggaccggctggaattctattatgacgaggaaaatcctgactacgtgatc
gtggggatggacacggacttgacctaccacaagctcatggttgccacccgctgcattcac
cggggagcggtctttatcggcaccaattccgaccagaacctgccggtgggcaaggagctg
cggccaggcaacggttcaatttgcgcggctctggaagtcgcgtccgggcaaaagcccctt
tttattggcaagccggaagccattattgtcaaccgcgccctggacttggctggggtcagg
gcggaagaggccttgattgtcggggacaattacccaactgacattatggccggaatcaac
agcggagtcgacaccctcttgaccttgaccggggtgacgcaaaaggcagacctggccggt
ctcactccgccgacttatttagtgaacgatttggatgaatttagcctatga

DBGET integrated database retrieval system