KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0410Help
Entry
LBU_0410          CDS       T01957                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00051  Fructose and mannose metabolism
ldl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LBU_0410
Enzymes [BR:ldl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LBU_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C
Motif
Other DBs
NCBI-ProteinID: ADY84595
UniProt: F0K0D6
Position
409586..409795
Genome map
AA seq 69 aa AA seqDB search
MEGVHYAPDLEPYIERKLFSVNTGHATVAYTGKALGYETIGEAVKDDRVVDQVTRVLAET
FPPFGQVGL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
ttggaaggcgttcactacgctccagaccttgaaccatacatcgaaagaaagctgttctca
gtcaatactggtcacgccactgttgcttacaccggcaaggctctgggctatgaaacgatt
ggggaagccgttaaggatgaccgtgtcgttgaccaggtaacccgcgttttggctgaaacg
ttccctccttttggccaagtgggactttag

DBGET integrated database retrieval system