KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0748Help
Entry
LBU_0748          CDS       T01957                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase thil
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00071  Fatty acid degradation
ldl00072  Synthesis and degradation of ketone bodies
ldl00280  Valine, leucine and isoleucine degradation
ldl00362  Benzoate degradation
ldl00620  Pyruvate metabolism
ldl00630  Glyoxylate and dicarboxylate metabolism
ldl00640  Propanoate metabolism
ldl00650  Butanoate metabolism
ldl00900  Terpenoid backbone biosynthesis
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
ldl01200  Carbon metabolism
ldl01212  Fatty acid metabolism
ldl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ldl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBU_0748
   00630 Glyoxylate and dicarboxylate metabolism
    LBU_0748
   00640 Propanoate metabolism
    LBU_0748
   00650 Butanoate metabolism
    LBU_0748
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBU_0748
   00072 Synthesis and degradation of ketone bodies
    LBU_0748
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBU_0748
   00310 Lysine degradation
    LBU_0748
   00380 Tryptophan metabolism
    LBU_0748
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBU_0748
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBU_0748
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBU_0748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ldl04147]
    LBU_0748
Enzymes [BR:ldl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBU_0748
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBU_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADY84933
UniProt: F0K1W8
Position
757148..758248
Genome map
AA seq 366 aa AA seqDB search
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALRGALKEAGLDAEALDALFMGNVLAAG
LGQNMARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGMVAVGGSESMTN
APKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFAD
EIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVA
EYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLA
VARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIA
FEIEKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttatattgtcgcggccaagcgaactccatttggccgttaccacaagcaa
ttggctgacttttctgctatcgacctgggccaaatcgccctgcgcggcgcattaaaagaa
gccggccttgacgccgaagccctggatgccctcttcatgggcaatgtcctggctgccggc
ttaggccaaaacatggcccggcaaattgctttaaacgccgggatgcggcaggactcagtc
gccgtgtccatcaacgaagtctgtggctccagcctcaaggctgcccggctggctgaagcc
caaatgttaatcggtgacctgggcatggttgctgtcggcggcagcgaaagcatgaccaac
gccccaaaggaaatcatgttcagcgatggtctcgttgactccttctccggtaaatccatg
ggcattactgccgaaaacgtggctaagcgcaaccacatcagccgccaagacgctgacgcc
ttcagcttgtcctcccaccaaaaagctgtcaaagcacaagctgaaggactttttgccgat
gaaatcattcaaattgaagatctcaagcaagatgaaaacgtccgcccggataccagcctg
gaagccctggccggtcttaaaacttccttccttgaagacgggaccgtcactgccggtaac
gcctccccaatctccgacggggccagcatgatcatcctggctaccgcggaaaaagtcgct
gaataccagctgacgcctttagccaagctgggtgcttacgccgaagtaggctatgacccg
gaattcatgggctatggtccatactatgctatccgtaagctgcttaatgaaactggccgg
caggtagccgattacgacttctttgaaatcaatgaagcctttgccgcaactactttggct
gttgcccgcgacctggaaattcctttagccaaggtcaacaagcagggcggggcgattgct
ttaggccacccgctcggcgcttccggcacccgccttctggctaccgctgcccgccagctg
caaagaggcggccagcgcgctatcgccagcctttgcatcggaggcggcctggccatcgct
tttgaaattgagaaggcataa

DBGET integrated database retrieval system