KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0777Help
Entry
LBU_0777          CDS       T01957                                 

Definition
(GenBank) putative alcohol-acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00010  Glycolysis / Gluconeogenesis
ldl00071  Fatty acid degradation
ldl00620  Pyruvate metabolism
ldl00625  Chloroalkane and chloroalkene degradation
ldl00626  Naphthalene degradation
ldl00650  Butanoate metabolism
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
ldl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0777
   00620 Pyruvate metabolism
    LBU_0777
   00650 Butanoate metabolism
    LBU_0777
  Lipid metabolism
   00071 Fatty acid degradation
    LBU_0777
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBU_0777
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBU_0777
   00626 Naphthalene degradation
    LBU_0777
Enzymes [BR:ldl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBU_0777
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LBU_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADY84962
UniProt: F0K1Z7
Position
complement(786961..787902)
Genome map
AA seq 313 aa AA seqDB search
MATGGTGMVHAALQSGNPSMGVGAGNGAVYIDHTAFLDRAVEDILLSKRFDNSMVCATEN
SAVVEAPIYDKWLQMIQDKGAYLVPKKDYQKLADFVFNDKHGVNGPVAGMSARWICEHAG
VTLSEGKDVLLFELDPKNIGEKLSSEKLSPLLSVYKAKDREDGIRIVKALLDYQGAGHNA
AIQIGSQNDPFIDEYGKAVQASRVLVNQPDALGGIGDIYSDGLRPSLILGTGSWGKNSLS
HNLSTSDLLNIKTIAKRRNRPQWIRLPEKIFTKKTSLPIFQMKMSRKSAGPLSSLTWAWS
SSTSLTRSMNSWL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttggcaactggtggtaccggcatggtgcacgccgcgctgcagtctggcaacccgtcaatg
ggggtcggggccggcaacggtgctgtttacatcgaccacaccgcctttttggaccgggct
gttgaagacatacttttgtccaagcgttttgacaacagcatggtttgcgcgactgaaaac
tcagccgtagttgaagcaccgatctacgacaagtggctgcaaatgatacaggacaagggt
gcctacctggttccaaagaaagactaccaaaagctggccgacttcgtcttcaatgacaag
catggggtcaatgggccagtagccgggatgagcgcccgctggatttgtgaacacgccggc
gttaccctgtctgaaggcaaggatgtcctcctctttgaactggatccaaagaatattggc
gaaaagctgtcatccgaaaaactctccccgcttctgtcagtttacaaggccaaggatcgg
gaagacgggatcagaatcgtcaaagccctgcttgactaccaaggtgctggccacaatgcc
gccatccaaatcggctcccaaaacgatccgttcatcgatgaatacggcaaggcagtccaa
gcttccagagtcctggttaaccagccggacgctttgggcgggatcggcgatatctatagt
gatggcctgcggccaagcttgattttggggactggttcatgggggaagaactccctgtct
cacaacctgtcgaccagcgacctcttgaacatcaagaccattgccaagcggcggaaccgg
ccgcaatggatccgcctgccggagaagatttttacgaaaaagacttcattacctatcttt
cagatgaaaatgagcaggaaatcagccgggcctttatcgtcgctgacctgggcatggtca
agttccacttcgttgacaaggtctatgaacagctggctttaa

DBGET integrated database retrieval system